Related products

No related products found

Try browsing our complete catalog of products.

Reviews 0

No reviews have been added for this product.

Reviews

Protein Description: chromobox homolog 4
Gene Name: CBX4
Alternative Gene Name: hPC2, NBP16, PC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039989: 82%, ENSRNOG00000046207: 85%
Entrez Gene ID: 8535
Uniprot ID: O00257
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application	IHC
Reactivity	Human
Clonality	Polyclonal
Host	Rabbit
Immunogen	QPEVILLDSDLDEPIDLRCVKTRSEAGEPPSSLQVKPETPASAAVAVAAAAAPTTTAEKPPAEAQDEPAESLSEFKPFFGNIIITDVTANCLTVTFKEYVTV
Gene Sequence	QPEVILLDSDLDEPIDLRCVKTRSEAGEPPSSLQVKPETPASAAVAVAAAAAPTTTAEKPPAEAQDEPAESLSEFKPFFGNIIITDVTANCLTVTFKEYVTV
Gene ID - Mouse	ENSMUSG00000039989
Gene ID - Rat	ENSRNOG00000046207
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CBX4 pAb (ATL-HPA008228)
Datasheet	Anti CBX4 pAb (ATL-HPA008228) Datasheet (External Link)
Vendor Page	Anti CBX4 pAb (ATL-HPA008228) at Atlas Antibodies

Documents & Links for Anti CBX4 pAb (ATL-HPA008228)
Datasheet	Anti CBX4 pAb (ATL-HPA008228) Datasheet (External Link)
Vendor Page	Anti CBX4 pAb (ATL-HPA008228)

Citations for Anti CBX4 pAb (ATL-HPA008228) – 1 Found

Peuget, S; Bonacci, T; Soubeyran, P; Iovanna, J; Dusetti, N J. Oxidative stress-induced p53 activity is enhanced by a redox-sensitive TP53INP1 SUMOylation. Cell Death And Differentiation. 2014;21(7):1107-18. PubMed

No related products found

Reviews 0

Reviews

Anti CBX4 pAb (ATL-HPA008228)

Additional information

Anti CBX4 pAb (ATL-HPA008228)

Additional information

Specifications

No related products found

Reviews 0

Anti CBX4 pAb (ATL-HPA008228)

Additional information

Specifications

Anti CBX4 pAb (ATL-HPA008228)

Additional information

Specifications

Specifications