Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KDVEENVGLIVYNGAMVDVGSLLQKLEKSEKVRAEVEQKLQLLEEKTDEDEKTILNLENSNKSLSGELREVKKDLSQLQENLKISENMNLQFENQMNKTIRNLSTVMDEIHTVLKKDNVKNED |
| Gene Sequence | KDVEENVGLIVYNGAMVDVGSLLQKLEKSEKVRAEVEQKLQLLEEKTDEDEKTILNLENSNKSLSGELREVKKDLSQLQENLKISENMNLQFENQMNKTIRNLSTVMDEIHTVLKKDNVKNED |
| Gene ID - Mouse | ENSMUSG00000020074 |
| Gene ID - Rat | ENSRNOG00000000397 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CCAR1 pAb (ATL-HPA007856) | |
| Datasheet | Anti CCAR1 pAb (ATL-HPA007856) Datasheet (External Link) |
| Vendor Page | Anti CCAR1 pAb (ATL-HPA007856) at Atlas Antibodies |
| Documents & Links for Anti CCAR1 pAb (ATL-HPA007856) | |
| Datasheet | Anti CCAR1 pAb (ATL-HPA007856) Datasheet (External Link) |
| Vendor Page | Anti CCAR1 pAb (ATL-HPA007856) |
| Citations for Anti CCAR1 pAb (ATL-HPA007856) – 3 Found |
| Ha, Sang Yun; Kim, Jeong Hoon; Yang, Jung Wook; Kim, Jimin; Kim, Binnari; Park, Cheol-Keun. The Overexpression of CCAR1 in Hepatocellular Carcinoma Associates with Poor Prognosis. Cancer Research And Treatment. 2016;48(3):1065-73. PubMed |
| Mulder, Jan; Björling, Erik; Jonasson, Kalle; Wernérus, Henrik; Hober, Sophia; Hökfelt, Tomas; Uhlén, Mathias. Tissue profiling of the mammalian central nervous system using human antibody-based proteomics. Molecular & Cellular Proteomics : Mcp. 2009;8(7):1612-22. PubMed |
| Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51. PubMed |
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KDVEENVGLIVYNGAMVDVGSLLQKLEKSEKVRAEVEQKLQLLEEKTDEDEKTILNLENSNKSLSGELREVKKDLSQLQENLKISENMNLQFENQMNKTIRNLSTVMDEIHTVLKKDNVKNED |
| Gene Sequence | KDVEENVGLIVYNGAMVDVGSLLQKLEKSEKVRAEVEQKLQLLEEKTDEDEKTILNLENSNKSLSGELREVKKDLSQLQENLKISENMNLQFENQMNKTIRNLSTVMDEIHTVLKKDNVKNED |
| Gene ID - Mouse | ENSMUSG00000020074 |
| Gene ID - Rat | ENSRNOG00000000397 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CCAR1 pAb (ATL-HPA007856) | |
| Datasheet | Anti CCAR1 pAb (ATL-HPA007856) Datasheet (External Link) |
| Vendor Page | Anti CCAR1 pAb (ATL-HPA007856) at Atlas Antibodies |
| Documents & Links for Anti CCAR1 pAb (ATL-HPA007856) | |
| Datasheet | Anti CCAR1 pAb (ATL-HPA007856) Datasheet (External Link) |
| Vendor Page | Anti CCAR1 pAb (ATL-HPA007856) |
| Citations for Anti CCAR1 pAb (ATL-HPA007856) – 3 Found |
| Ha, Sang Yun; Kim, Jeong Hoon; Yang, Jung Wook; Kim, Jimin; Kim, Binnari; Park, Cheol-Keun. The Overexpression of CCAR1 in Hepatocellular Carcinoma Associates with Poor Prognosis. Cancer Research And Treatment. 2016;48(3):1065-73. PubMed |
| Mulder, Jan; Björling, Erik; Jonasson, Kalle; Wernérus, Henrik; Hober, Sophia; Hökfelt, Tomas; Uhlén, Mathias. Tissue profiling of the mammalian central nervous system using human antibody-based proteomics. Molecular & Cellular Proteomics : Mcp. 2009;8(7):1612-22. PubMed |
| Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51. PubMed |