Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SLDEQTEQSENLQVQLEHLQSRLRRQQQNAPLFGKIRSARFGTEEAEDGTSDLD |
| Gene Sequence | SLDEQTEQSENLQVQLEHLQSRLRRQQQNAPLFGKIRSARFGTEEAEDGTSDLD |
| Gene ID - Mouse | ENSMUSG00000063605 |
| Gene ID - Rat | ENSRNOG00000025843 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CCDC102A pAb (ATL-HPA040598) | |
| Datasheet | Anti CCDC102A pAb (ATL-HPA040598) Datasheet (External Link) |
| Vendor Page | Anti CCDC102A pAb (ATL-HPA040598) at Atlas Antibodies |
| Documents & Links for Anti CCDC102A pAb (ATL-HPA040598) | |
| Datasheet | Anti CCDC102A pAb (ATL-HPA040598) Datasheet (External Link) |
| Vendor Page | Anti CCDC102A pAb (ATL-HPA040598) |
| Citations for Anti CCDC102A pAb (ATL-HPA040598) – 1 Found |
| Bachmann, Julie; Burté, Florence; Pramana, Setia; Conte, Ianina; Brown, Biobele J; Orimadegun, Adebola E; Ajetunmobi, Wasiu A; Afolabi, Nathaniel K; Akinkunmi, Francis; Omokhodion, Samuel; Akinbami, Felix O; Shokunbi, Wuraola A; Kampf, Caroline; Pawitan, Yudi; Uhlén, Mathias; Sodeinde, Olugbemiro; Schwenk, Jochen M; Wahlgren, Mats; Fernandez-Reyes, Delmiro; Nilsson, Peter. Affinity proteomics reveals elevated muscle proteins in plasma of children with cerebral malaria. Plos Pathogens. 2014;10(4):e1004038. PubMed |
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SLDEQTEQSENLQVQLEHLQSRLRRQQQNAPLFGKIRSARFGTEEAEDGTSDLD |
| Gene Sequence | SLDEQTEQSENLQVQLEHLQSRLRRQQQNAPLFGKIRSARFGTEEAEDGTSDLD |
| Gene ID - Mouse | ENSMUSG00000063605 |
| Gene ID - Rat | ENSRNOG00000025843 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CCDC102A pAb (ATL-HPA040598) | |
| Datasheet | Anti CCDC102A pAb (ATL-HPA040598) Datasheet (External Link) |
| Vendor Page | Anti CCDC102A pAb (ATL-HPA040598) at Atlas Antibodies |
| Documents & Links for Anti CCDC102A pAb (ATL-HPA040598) | |
| Datasheet | Anti CCDC102A pAb (ATL-HPA040598) Datasheet (External Link) |
| Vendor Page | Anti CCDC102A pAb (ATL-HPA040598) |
| Citations for Anti CCDC102A pAb (ATL-HPA040598) – 1 Found |
| Bachmann, Julie; Burté, Florence; Pramana, Setia; Conte, Ianina; Brown, Biobele J; Orimadegun, Adebola E; Ajetunmobi, Wasiu A; Afolabi, Nathaniel K; Akinkunmi, Francis; Omokhodion, Samuel; Akinbami, Felix O; Shokunbi, Wuraola A; Kampf, Caroline; Pawitan, Yudi; Uhlén, Mathias; Sodeinde, Olugbemiro; Schwenk, Jochen M; Wahlgren, Mats; Fernandez-Reyes, Delmiro; Nilsson, Peter. Affinity proteomics reveals elevated muscle proteins in plasma of children with cerebral malaria. Plos Pathogens. 2014;10(4):e1004038. PubMed |