Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies
![Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18<br/>Lane 2: Human cell line RT-4](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/40937/16937/atl-hpa000888_anti-ccdc22-pab-atl-hpa000888_27522__28050.1783622110.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YQNFLYPSEPDLRDLLLFLAERLPTDASEDADQPAGDSAILLRAIGSQIRDQLALPWVPPHLRTPKLQHLQGSALQKPFHASRLVVPELSSRGEPREFQASPLLLPVPTQVPQPVGRVA |
| Gene Sequence | YQNFLYPSEPDLRDLLLFLAERLPTDASEDADQPAGDSAILLRAIGSQIRDQLALPWVPPHLRTPKLQHLQGSALQKPFHASRLVVPELSSRGEPREFQASPLLLPVPTQVPQPVGRVA |
| Gene ID - Mouse | ENSMUSG00000031143 |
| Gene ID - Rat | ENSRNOG00000010846 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CCDC22 pAb (ATL-HPA000888) | |
| Datasheet | Anti CCDC22 pAb (ATL-HPA000888) Datasheet (External Link) |
| Vendor Page | Anti CCDC22 pAb (ATL-HPA000888) at Atlas Antibodies |
| Documents & Links for Anti CCDC22 pAb (ATL-HPA000888) | |
| Datasheet | Anti CCDC22 pAb (ATL-HPA000888) Datasheet (External Link) |
| Vendor Page | Anti CCDC22 pAb (ATL-HPA000888) |
| Citations for Anti CCDC22 pAb (ATL-HPA000888) – 1 Found |
| Kolanczyk, Mateusz; Krawitz, Peter; Hecht, Jochen; Hupalowska, Anna; Miaczynska, Marta; Marschner, Katrin; Schlack, Claire; Emmerich, Denise; Kobus, Karolina; Kornak, Uwe; Robinson, Peter N; Plecko, Barbara; Grangl, Gernot; Uhrig, Sabine; Mundlos, Stefan; Horn, Denise. Missense variant in CCDC22 causes X-linked recessive intellectual disability with features of Ritscher-Schinzel/3C syndrome. European Journal Of Human Genetics : Ejhg. 2015;23(5):633-8. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YQNFLYPSEPDLRDLLLFLAERLPTDASEDADQPAGDSAILLRAIGSQIRDQLALPWVPPHLRTPKLQHLQGSALQKPFHASRLVVPELSSRGEPREFQASPLLLPVPTQVPQPVGRVA |
| Gene Sequence | YQNFLYPSEPDLRDLLLFLAERLPTDASEDADQPAGDSAILLRAIGSQIRDQLALPWVPPHLRTPKLQHLQGSALQKPFHASRLVVPELSSRGEPREFQASPLLLPVPTQVPQPVGRVA |
| Gene ID - Mouse | ENSMUSG00000031143 |
| Gene ID - Rat | ENSRNOG00000010846 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CCDC22 pAb (ATL-HPA000888) | |
| Datasheet | Anti CCDC22 pAb (ATL-HPA000888) Datasheet (External Link) |
| Vendor Page | Anti CCDC22 pAb (ATL-HPA000888) at Atlas Antibodies |
| Documents & Links for Anti CCDC22 pAb (ATL-HPA000888) | |
| Datasheet | Anti CCDC22 pAb (ATL-HPA000888) Datasheet (External Link) |
| Vendor Page | Anti CCDC22 pAb (ATL-HPA000888) |
| Citations for Anti CCDC22 pAb (ATL-HPA000888) – 1 Found |
| Kolanczyk, Mateusz; Krawitz, Peter; Hecht, Jochen; Hupalowska, Anna; Miaczynska, Marta; Marschner, Katrin; Schlack, Claire; Emmerich, Denise; Kobus, Karolina; Kornak, Uwe; Robinson, Peter N; Plecko, Barbara; Grangl, Gernot; Uhrig, Sabine; Mundlos, Stefan; Horn, Denise. Missense variant in CCDC22 causes X-linked recessive intellectual disability with features of Ritscher-Schinzel/3C syndrome. European Journal Of Human Genetics : Ejhg. 2015;23(5):633-8. PubMed |