Related products

No related products found

Try browsing our complete catalog of products.

Reviews 0

No reviews have been added for this product.

Reviews

Protein Description: cyclin B2
Gene Name: CCNB2
Alternative Gene Name: HsT17299
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032218: 81%, ENSRNOG00000058539: 27%
Entrez Gene ID: 9133
Uniprot ID: O95067
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application	WB, ICC, IHC
Reactivity	Human
Clonality	Polyclonal
Host	Rabbit
Immunogen	TVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPVQPTKTTNVNKQLKPTASVKPVQMEKLAPKGPSPTPEDVSMKEENLCQAFSDALLCKIEDIDNEDWENPQLC
Gene Sequence	TVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPVQPTKTTNVNKQLKPTASVKPVQMEKLAPKGPSPTPEDVSMKEENLCQAFSDALLCKIEDIDNEDWENPQLC
Gene ID - Mouse	ENSMUSG00000032218
Gene ID - Rat	ENSRNOG00000058539
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCNB2 pAb (ATL-HPA008873 w/enhanced validation)
Datasheet	Anti CCNB2 pAb (ATL-HPA008873 w/enhanced validation) Datasheet (External Link)
Vendor Page	Anti CCNB2 pAb (ATL-HPA008873 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CCNB2 pAb (ATL-HPA008873 w/enhanced validation)
Datasheet	Anti CCNB2 pAb (ATL-HPA008873 w/enhanced validation) Datasheet (External Link)
Vendor Page	Anti CCNB2 pAb (ATL-HPA008873 w/enhanced validation)

Citations for Anti CCNB2 pAb (ATL-HPA008873 w/enhanced validation) – 1 Found

Shubbar, Emman; Kovács, Anikó; Hajizadeh, Shahin; Parris, Toshima Z; Nemes, Szilárd; Gunnarsdóttir, Katrin; Einbeigi, Zakaria; Karlsson, Per; Helou, Khalil. Elevated cyclin B2 expression in invasive breast carcinoma is associated with unfavorable clinical outcome. Bmc Cancer. 2013;13( 23282137):1. PubMed

No related products found

Reviews 0

Reviews

Anti CCNB2 pAb (ATL-HPA008873 w/enhanced validation)

Additional information

Specifications

Anti CCNB2 pAb (ATL-HPA008873 w/enhanced validation)

Additional information

Specifications

Reviews 0

No related products found

Anti CCNB2 pAb (ATL-HPA008873 w/enhanced validation)

Additional information

Anti CCNB2 pAb (ATL-HPA008873 w/enhanced validation)

Additional information

Specifications

Specifications