Related products

No related products found

Try browsing our complete catalog of products.

Reviews 0

No reviews have been added for this product.

Reviews

Protein Description: cyclin D2
Gene Name: CCND2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000184: 70%, ENSRNOG00000057710: 74%
Entrez Gene ID: 894
Uniprot ID: P30279
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application	ICC
Reactivity	Human
Clonality	Polyclonal
Host	Rabbit
Immunogen	QEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRGIDL
Gene Sequence	QEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRGIDL
Gene ID - Mouse	ENSMUSG00000000184
Gene ID - Rat	ENSRNOG00000057710
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCND2 pAb (ATL-HPA049138)
Datasheet	Anti CCND2 pAb (ATL-HPA049138) Datasheet (External Link)
Vendor Page	Anti CCND2 pAb (ATL-HPA049138) at Atlas Antibodies

Documents & Links for Anti CCND2 pAb (ATL-HPA049138)
Datasheet	Anti CCND2 pAb (ATL-HPA049138) Datasheet (External Link)
Vendor Page	Anti CCND2 pAb (ATL-HPA049138)

Citations for Anti CCND2 pAb (ATL-HPA049138) – 1 Found

Danielsson, Frida; Wiking, Mikaela; Mahdessian, Diana; Skogs, Marie; Ait Blal, Hammou; Hjelmare, Martin; Stadler, Charlotte; Uhlén, Mathias; Lundberg, Emma. RNA deep sequencing as a tool for selection of cell lines for systematic subcellular localization of all human proteins. Journal Of Proteome Research. 2013;12(1):299-307. PubMed

No related products found

Reviews 0

Reviews

Anti CCND2 pAb (ATL-HPA049138)

Additional information

Anti CCND2 pAb (ATL-HPA049138)

Additional information

Specifications

No related products found

Reviews 0

Anti CCND2 pAb (ATL-HPA049138)

Additional information

Specifications

Anti CCND2 pAb (ATL-HPA049138)

Additional information

Specifications

Specifications