Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DELNDMKDYLSQCQQEQESFIDYKSLKENLARCWTLTEAEKMSFETQKTNLATENQYLRVSLEKEEKALSSLQEELNKLREQIRILEDKGTSTELVKENQKLKQHLEEEKQKKHSFLSQRETLL |
| Gene Sequence | DELNDMKDYLSQCQQEQESFIDYKSLKENLARCWTLTEAEKMSFETQKTNLATENQYLRVSLEKEEKALSSLQEELNKLREQIRILEDKGTSTELVKENQKLKQHLEEEKQKKHSFLSQRETLL |
| Gene ID - Mouse | ENSMUSG00000034563 |
| Gene ID - Rat | ENSRNOG00000053428 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CCPG1 pAb (ATL-HPA026861) | |
| Datasheet | Anti CCPG1 pAb (ATL-HPA026861) Datasheet (External Link) |
| Vendor Page | Anti CCPG1 pAb (ATL-HPA026861) at Atlas Antibodies |
| Documents & Links for Anti CCPG1 pAb (ATL-HPA026861) | |
| Datasheet | Anti CCPG1 pAb (ATL-HPA026861) Datasheet (External Link) |
| Vendor Page | Anti CCPG1 pAb (ATL-HPA026861) |
| Citations for Anti CCPG1 pAb (ATL-HPA026861) – 2 Found |
| Baras, Alexander S; Gandhi, Nilay; Munari, Enrico; Faraj, Sheila; Shultz, Luciana; Marchionni, Luigi; Schoenberg, Mark; Hahn, Noah; Hoque, Mohammad Obaidul; Berman, David; Bivalacqua, Trinity J; Netto, George. Identification and Validation of Protein Biomarkers of Response to Neoadjuvant Platinum Chemotherapy in Muscle Invasive Urothelial Carcinoma. Plos One. 10(7):e0131245. PubMed |
| Rizzardi, Anthony E; Rosener, Nikolaus K; Koopmeiners, Joseph S; Isaksson Vogel, Rachel; Metzger, Gregory J; Forster, Colleen L; Marston, Lauren O; Tiffany, Jessica R; McCarthy, James B; Turley, Eva A; Warlick, Christopher A; Henriksen, Jonathan C; Schmechel, Stephen C. Evaluation of protein biomarkers of prostate cancer aggressiveness. Bmc Cancer. 2014;14( 24708576):244. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DELNDMKDYLSQCQQEQESFIDYKSLKENLARCWTLTEAEKMSFETQKTNLATENQYLRVSLEKEEKALSSLQEELNKLREQIRILEDKGTSTELVKENQKLKQHLEEEKQKKHSFLSQRETLL |
| Gene Sequence | DELNDMKDYLSQCQQEQESFIDYKSLKENLARCWTLTEAEKMSFETQKTNLATENQYLRVSLEKEEKALSSLQEELNKLREQIRILEDKGTSTELVKENQKLKQHLEEEKQKKHSFLSQRETLL |
| Gene ID - Mouse | ENSMUSG00000034563 |
| Gene ID - Rat | ENSRNOG00000053428 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CCPG1 pAb (ATL-HPA026861) | |
| Datasheet | Anti CCPG1 pAb (ATL-HPA026861) Datasheet (External Link) |
| Vendor Page | Anti CCPG1 pAb (ATL-HPA026861) at Atlas Antibodies |
| Documents & Links for Anti CCPG1 pAb (ATL-HPA026861) | |
| Datasheet | Anti CCPG1 pAb (ATL-HPA026861) Datasheet (External Link) |
| Vendor Page | Anti CCPG1 pAb (ATL-HPA026861) |
| Citations for Anti CCPG1 pAb (ATL-HPA026861) – 2 Found |
| Baras, Alexander S; Gandhi, Nilay; Munari, Enrico; Faraj, Sheila; Shultz, Luciana; Marchionni, Luigi; Schoenberg, Mark; Hahn, Noah; Hoque, Mohammad Obaidul; Berman, David; Bivalacqua, Trinity J; Netto, George. Identification and Validation of Protein Biomarkers of Response to Neoadjuvant Platinum Chemotherapy in Muscle Invasive Urothelial Carcinoma. Plos One. 10(7):e0131245. PubMed |
| Rizzardi, Anthony E; Rosener, Nikolaus K; Koopmeiners, Joseph S; Isaksson Vogel, Rachel; Metzger, Gregory J; Forster, Colleen L; Marston, Lauren O; Tiffany, Jessica R; McCarthy, James B; Turley, Eva A; Warlick, Christopher A; Henriksen, Jonathan C; Schmechel, Stephen C. Evaluation of protein biomarkers of prostate cancer aggressiveness. Bmc Cancer. 2014;14( 24708576):244. PubMed |