Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies






| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ELKAEKDNAEIRVHTVEDYQAIVDAEWNILYDKLEKIHHSGAKVVLSKLPIGDVATQYFADRDMFCAGRVPEEDLKRTMMACGGSIQTSVNALSADVLGRCQVFEETQIGGERYNFFTGCPKAKTCTFILRGGAEQFMEETE |
| Gene Sequence | ELKAEKDNAEIRVHTVEDYQAIVDAEWNILYDKLEKIHHSGAKVVLSKLPIGDVATQYFADRDMFCAGRVPEEDLKRTMMACGGSIQTSVNALSADVLGRCQVFEETQIGGERYNFFTGCPKAKTCTFILRGGAEQFMEETE |
| Gene ID - Mouse | ENSMUSG00000030007 |
| Gene ID - Rat | ENSRNOG00000015630 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CCT7 pAb (ATL-HPA008425 w/enhanced validation) | |
| Datasheet | Anti CCT7 pAb (ATL-HPA008425 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CCT7 pAb (ATL-HPA008425 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CCT7 pAb (ATL-HPA008425 w/enhanced validation) | |
| Datasheet | Anti CCT7 pAb (ATL-HPA008425 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CCT7 pAb (ATL-HPA008425 w/enhanced validation) |
| Citations for Anti CCT7 pAb (ATL-HPA008425 w/enhanced validation) – 5 Found |
| Hurley, Paula J; Sundi, Debasish; Shinder, Brian; Simons, Brian W; Hughes, Robert M; Miller, Rebecca M; Benzon, Benjamin; Faraj, Sheila F; Netto, George J; Vergara, Ismael A; Erho, Nicholas; Davicioni, Elai; Karnes, R Jeffrey; Yan, Guifang; Ewing, Charles; Isaacs, Sarah D; Berman, David M; Rider, Jennifer R; Jordahl, Kristina M; Mucci, Lorelei A; Huang, Jessie; An, Steven S; Park, Ben H; Isaacs, William B; Marchionni, Luigi; Ross, Ashley E; Schaeffer, Edward M. Germline Variants in Asporin Vary by Race, Modulate the Tumor Microenvironment, and Are Differentially Associated with Metastatic Prostate Cancer. Clinical Cancer Research : An Official Journal Of The American Association For Cancer Research. 2016;22(2):448-58. PubMed |
| Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51. PubMed |
| Erdmann, Jeanette; Stark, Klaus; Esslinger, Ulrike B; Rumpf, Philipp Moritz; Koesling, Doris; de Wit, Cor; Kaiser, Frank J; Braunholz, Diana; Medack, Anja; Fischer, Marcus; Zimmermann, Martina E; Tennstedt, Stephanie; Graf, Elisabeth; Eck, Sebastian; Aherrahrou, Zouhair; Nahrstaedt, Janja; Willenborg, Christina; Bruse, Petra; Brænne, Ingrid; Nöthen, Markus M; Hofmann, Per; Braund, Peter S; Mergia, Evanthia; Reinhard, Wibke; Burgdorf, Christof; Schreiber, Stefan; Balmforth, Anthony J; Hall, Alistair S; Bertram, Lars; Steinhagen-Thiessen, Elisabeth; Li, Shu-Chen; März, Winfried; Reilly, Muredach; Kathiresan, Sekar; McPherson, Ruth; Walter, Ulrich; Ott, Jurg; Samani, Nilesh J; Strom, Tim M; Meitinger, Thomas; Hengstenberg, Christian; Schunkert, Heribert. Dysfunctional nitric oxide signalling increases risk of myocardial infarction. Nature. 2013;504(7480):432-6. PubMed |
| Pavel, Mariana; Imarisio, Sara; Menzies, Fiona M; Jimenez-Sanchez, Maria; Siddiqi, Farah H; Wu, Xiaoting; Renna, Maurizio; O'Kane, Cahir J; Crowther, Damian C; Rubinsztein, David C. CCT complex restricts neuropathogenic protein aggregation via autophagy. Nature Communications. 2016;7( 27929117):13821. PubMed |
| Shaheen, Najma; Akhtar, Jawad; Umer, Zain; Khan, Muhammad Haider Farooq; Bakhtiari, Mahnoor Hussain; Saleem, Murtaza; Faisal, Amir; Tariq, Muhammad. Polycomb Requires Chaperonin Containing TCP-1 Subunit 7 for Maintaining Gene Silencing in Drosophila. Frontiers In Cell And Developmental Biology. 9( 34660585):727972. PubMed |






| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ELKAEKDNAEIRVHTVEDYQAIVDAEWNILYDKLEKIHHSGAKVVLSKLPIGDVATQYFADRDMFCAGRVPEEDLKRTMMACGGSIQTSVNALSADVLGRCQVFEETQIGGERYNFFTGCPKAKTCTFILRGGAEQFMEETE |
| Gene Sequence | ELKAEKDNAEIRVHTVEDYQAIVDAEWNILYDKLEKIHHSGAKVVLSKLPIGDVATQYFADRDMFCAGRVPEEDLKRTMMACGGSIQTSVNALSADVLGRCQVFEETQIGGERYNFFTGCPKAKTCTFILRGGAEQFMEETE |
| Gene ID - Mouse | ENSMUSG00000030007 |
| Gene ID - Rat | ENSRNOG00000015630 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CCT7 pAb (ATL-HPA008425 w/enhanced validation) | |
| Datasheet | Anti CCT7 pAb (ATL-HPA008425 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CCT7 pAb (ATL-HPA008425 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CCT7 pAb (ATL-HPA008425 w/enhanced validation) | |
| Datasheet | Anti CCT7 pAb (ATL-HPA008425 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CCT7 pAb (ATL-HPA008425 w/enhanced validation) |
| Citations for Anti CCT7 pAb (ATL-HPA008425 w/enhanced validation) – 5 Found |
| Hurley, Paula J; Sundi, Debasish; Shinder, Brian; Simons, Brian W; Hughes, Robert M; Miller, Rebecca M; Benzon, Benjamin; Faraj, Sheila F; Netto, George J; Vergara, Ismael A; Erho, Nicholas; Davicioni, Elai; Karnes, R Jeffrey; Yan, Guifang; Ewing, Charles; Isaacs, Sarah D; Berman, David M; Rider, Jennifer R; Jordahl, Kristina M; Mucci, Lorelei A; Huang, Jessie; An, Steven S; Park, Ben H; Isaacs, William B; Marchionni, Luigi; Ross, Ashley E; Schaeffer, Edward M. Germline Variants in Asporin Vary by Race, Modulate the Tumor Microenvironment, and Are Differentially Associated with Metastatic Prostate Cancer. Clinical Cancer Research : An Official Journal Of The American Association For Cancer Research. 2016;22(2):448-58. PubMed |
| Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51. PubMed |
| Erdmann, Jeanette; Stark, Klaus; Esslinger, Ulrike B; Rumpf, Philipp Moritz; Koesling, Doris; de Wit, Cor; Kaiser, Frank J; Braunholz, Diana; Medack, Anja; Fischer, Marcus; Zimmermann, Martina E; Tennstedt, Stephanie; Graf, Elisabeth; Eck, Sebastian; Aherrahrou, Zouhair; Nahrstaedt, Janja; Willenborg, Christina; Bruse, Petra; Brænne, Ingrid; Nöthen, Markus M; Hofmann, Per; Braund, Peter S; Mergia, Evanthia; Reinhard, Wibke; Burgdorf, Christof; Schreiber, Stefan; Balmforth, Anthony J; Hall, Alistair S; Bertram, Lars; Steinhagen-Thiessen, Elisabeth; Li, Shu-Chen; März, Winfried; Reilly, Muredach; Kathiresan, Sekar; McPherson, Ruth; Walter, Ulrich; Ott, Jurg; Samani, Nilesh J; Strom, Tim M; Meitinger, Thomas; Hengstenberg, Christian; Schunkert, Heribert. Dysfunctional nitric oxide signalling increases risk of myocardial infarction. Nature. 2013;504(7480):432-6. PubMed |
| Pavel, Mariana; Imarisio, Sara; Menzies, Fiona M; Jimenez-Sanchez, Maria; Siddiqi, Farah H; Wu, Xiaoting; Renna, Maurizio; O'Kane, Cahir J; Crowther, Damian C; Rubinsztein, David C. CCT complex restricts neuropathogenic protein aggregation via autophagy. Nature Communications. 2016;7( 27929117):13821. PubMed |
| Shaheen, Najma; Akhtar, Jawad; Umer, Zain; Khan, Muhammad Haider Farooq; Bakhtiari, Mahnoor Hussain; Saleem, Murtaza; Faisal, Amir; Tariq, Muhammad. Polycomb Requires Chaperonin Containing TCP-1 Subunit 7 for Maintaining Gene Silencing in Drosophila. Frontiers In Cell And Developmental Biology. 9( 34660585):727972. PubMed |