Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies


![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue<br/>Lane 6: Human Tonsil tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/55142/42776/atl-hpa050006_anti-ccz1-pab-atl-hpa050006_54127__62271.1783640650.jpg?compression=lossy)


![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue<br/>Lane 6: Human Tonsil tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/55142/42776/atl-hpa050006_anti-ccz1-pab-atl-hpa050006_54127__62271.1783640650.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LLSFFIYNPRFGPREGQEENKILFYHPNEVEKNEKIRNVGLCEAIVQFTRTFSPSKPAKSLHTQKNRQFFNEPEENFWMVMVVRNPIIEKQSKDGKPVIEY |
| Gene Sequence | LLSFFIYNPRFGPREGQEENKILFYHPNEVEKNEKIRNVGLCEAIVQFTRTFSPSKPAKSLHTQKNRQFFNEPEENFWMVMVVRNPIIEKQSKDGKPVIEY |
| Gene ID - Mouse | ENSMUSG00000029617 |
| Gene ID - Rat | ENSRNOG00000001032 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CCZ1 pAb (ATL-HPA050006) | |
| Datasheet | Anti CCZ1 pAb (ATL-HPA050006) Datasheet (External Link) |
| Vendor Page | Anti CCZ1 pAb (ATL-HPA050006) at Atlas Antibodies |
| Documents & Links for Anti CCZ1 pAb (ATL-HPA050006) | |
| Datasheet | Anti CCZ1 pAb (ATL-HPA050006) Datasheet (External Link) |
| Vendor Page | Anti CCZ1 pAb (ATL-HPA050006) |
Try browsing our complete catalog of products.
Atlas Antibodies


![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue<br/>Lane 6: Human Tonsil tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/55142/42776/atl-hpa050006_anti-ccz1-pab-atl-hpa050006_54127__62271.1783640650.jpg?compression=lossy)


![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue<br/>Lane 6: Human Tonsil tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/55142/42776/atl-hpa050006_anti-ccz1-pab-atl-hpa050006_54127__62271.1783640650.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LLSFFIYNPRFGPREGQEENKILFYHPNEVEKNEKIRNVGLCEAIVQFTRTFSPSKPAKSLHTQKNRQFFNEPEENFWMVMVVRNPIIEKQSKDGKPVIEY |
| Gene Sequence | LLSFFIYNPRFGPREGQEENKILFYHPNEVEKNEKIRNVGLCEAIVQFTRTFSPSKPAKSLHTQKNRQFFNEPEENFWMVMVVRNPIIEKQSKDGKPVIEY |
| Gene ID - Mouse | ENSMUSG00000029617 |
| Gene ID - Rat | ENSRNOG00000001032 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CCZ1 pAb (ATL-HPA050006) | |
| Datasheet | Anti CCZ1 pAb (ATL-HPA050006) Datasheet (External Link) |
| Vendor Page | Anti CCZ1 pAb (ATL-HPA050006) at Atlas Antibodies |
| Documents & Links for Anti CCZ1 pAb (ATL-HPA050006) | |
| Datasheet | Anti CCZ1 pAb (ATL-HPA050006) Datasheet (External Link) |
| Vendor Page | Anti CCZ1 pAb (ATL-HPA050006) |