Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QNLVSGWLSDLQTHTWDSNSSTIVFLCPWSRGNFSNEEWKELETLFRIRTIRSFEGIRRYAHELQFEYPFEIQVTGGCELHSGKVSGSFLQLAYQGSDFVSFQNNSWLPYPVAGNMAKHFCKVLNQNQHEND |
| Gene Sequence | QNLVSGWLSDLQTHTWDSNSSTIVFLCPWSRGNFSNEEWKELETLFRIRTIRSFEGIRRYAHELQFEYPFEIQVTGGCELHSGKVSGSFLQLAYQGSDFVSFQNNSWLPYPVAGNMAKHFCKVLNQNQHEND |
| Gene ID - Mouse | ENSMUSG00000028076 |
| Gene ID - Rat | ENSRNOG00000016451 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CD1A pAb (ATL-HPA010734 w/enhanced validation) | |
| Datasheet | Anti CD1A pAb (ATL-HPA010734 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD1A pAb (ATL-HPA010734 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CD1A pAb (ATL-HPA010734 w/enhanced validation) | |
| Datasheet | Anti CD1A pAb (ATL-HPA010734 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD1A pAb (ATL-HPA010734 w/enhanced validation) |
| Citations for Anti CD1A pAb (ATL-HPA010734 w/enhanced validation) – 2 Found |
| Günther, Claudia; Zimmermann, Nick; Berndt, Nicole; Grosser, Marianne; Stein, Annette; Koch, Andre; Meurer, Michael. Up-regulation of the chemokine CCL18 by macrophages is a potential immunomodulatory pathway in cutaneous T-cell lymphoma. The American Journal Of Pathology. 2011;179(3):1434-42. PubMed |
| Günther, C; Starke, J; Zimmermann, N; Schäkel, K. Human 6-sulfo LacNAc (slan) dendritic cells are a major population of dermal dendritic cells in steady state and inflammation. Clinical And Experimental Dermatology. 2012;37(2):169-76. PubMed |
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QNLVSGWLSDLQTHTWDSNSSTIVFLCPWSRGNFSNEEWKELETLFRIRTIRSFEGIRRYAHELQFEYPFEIQVTGGCELHSGKVSGSFLQLAYQGSDFVSFQNNSWLPYPVAGNMAKHFCKVLNQNQHEND |
| Gene Sequence | QNLVSGWLSDLQTHTWDSNSSTIVFLCPWSRGNFSNEEWKELETLFRIRTIRSFEGIRRYAHELQFEYPFEIQVTGGCELHSGKVSGSFLQLAYQGSDFVSFQNNSWLPYPVAGNMAKHFCKVLNQNQHEND |
| Gene ID - Mouse | ENSMUSG00000028076 |
| Gene ID - Rat | ENSRNOG00000016451 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CD1A pAb (ATL-HPA010734 w/enhanced validation) | |
| Datasheet | Anti CD1A pAb (ATL-HPA010734 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD1A pAb (ATL-HPA010734 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CD1A pAb (ATL-HPA010734 w/enhanced validation) | |
| Datasheet | Anti CD1A pAb (ATL-HPA010734 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD1A pAb (ATL-HPA010734 w/enhanced validation) |
| Citations for Anti CD1A pAb (ATL-HPA010734 w/enhanced validation) – 2 Found |
| Günther, Claudia; Zimmermann, Nick; Berndt, Nicole; Grosser, Marianne; Stein, Annette; Koch, Andre; Meurer, Michael. Up-regulation of the chemokine CCL18 by macrophages is a potential immunomodulatory pathway in cutaneous T-cell lymphoma. The American Journal Of Pathology. 2011;179(3):1434-42. PubMed |
| Günther, C; Starke, J; Zimmermann, N; Schäkel, K. Human 6-sulfo LacNAc (slan) dendritic cells are a major population of dermal dendritic cells in steady state and inflammation. Clinical And Experimental Dermatology. 2012;37(2):169-76. PubMed |