Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies

![Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human cell line Daudi](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/50675/35195/atl-hpa038936_anti-cd27-pab-atl-hpa038936-wenhanced-validation_46280__98125.1783635498.jpg?compression=lossy)

![Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human cell line Daudi](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/50675/35195/atl-hpa038936_anti-cd27-pab-atl-hpa038936-wenhanced-validation_46280__98125.1783635498.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYR |
| Gene Sequence | HQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYR |
| Gene ID - Mouse | ENSMUSG00000030336 |
| Gene ID - Rat | ENSRNOG00000027466 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CD27 pAb (ATL-HPA038936 w/enhanced validation) | |
| Datasheet | Anti CD27 pAb (ATL-HPA038936 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD27 pAb (ATL-HPA038936 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CD27 pAb (ATL-HPA038936 w/enhanced validation) | |
| Datasheet | Anti CD27 pAb (ATL-HPA038936 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD27 pAb (ATL-HPA038936 w/enhanced validation) |
| Citations for Anti CD27 pAb (ATL-HPA038936 w/enhanced validation) – 2 Found |
| Kashima, Jumpei; Hishima, Tsunekazu; Okuma, Yusuke; Horio, Hirotoshi; Ogawa, Masumi; Hayashi, Yukiko; Horiguchi, Shin-Ichiro; Motoi, Toru; Ushiku, Tetsuo; Fukayama, Masashi. CD70 in Thymic Squamous Cell Carcinoma: Potential Diagnostic Markers and Immunotherapeutic Targets. Frontiers In Oncology. 11( 35145909):808396. PubMed |
| Bell, Luisa; Lenhart, Alexander; Rosenwald, Andreas; Monoranu, Camelia M; Berberich-Siebelt, Friederike. Lymphoid Aggregates in the CNS of Progressive Multiple Sclerosis Patients Lack Regulatory T Cells. Frontiers In Immunology. 10( 32010141):3090. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies

![Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human cell line Daudi](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/50675/35195/atl-hpa038936_anti-cd27-pab-atl-hpa038936-wenhanced-validation_46280__98125.1783635498.jpg?compression=lossy)

![Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human cell line Daudi](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/50675/35195/atl-hpa038936_anti-cd27-pab-atl-hpa038936-wenhanced-validation_46280__98125.1783635498.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYR |
| Gene Sequence | HQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYR |
| Gene ID - Mouse | ENSMUSG00000030336 |
| Gene ID - Rat | ENSRNOG00000027466 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CD27 pAb (ATL-HPA038936 w/enhanced validation) | |
| Datasheet | Anti CD27 pAb (ATL-HPA038936 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD27 pAb (ATL-HPA038936 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CD27 pAb (ATL-HPA038936 w/enhanced validation) | |
| Datasheet | Anti CD27 pAb (ATL-HPA038936 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD27 pAb (ATL-HPA038936 w/enhanced validation) |
| Citations for Anti CD27 pAb (ATL-HPA038936 w/enhanced validation) – 2 Found |
| Kashima, Jumpei; Hishima, Tsunekazu; Okuma, Yusuke; Horio, Hirotoshi; Ogawa, Masumi; Hayashi, Yukiko; Horiguchi, Shin-Ichiro; Motoi, Toru; Ushiku, Tetsuo; Fukayama, Masashi. CD70 in Thymic Squamous Cell Carcinoma: Potential Diagnostic Markers and Immunotherapeutic Targets. Frontiers In Oncology. 11( 35145909):808396. PubMed |
| Bell, Luisa; Lenhart, Alexander; Rosenwald, Andreas; Monoranu, Camelia M; Berberich-Siebelt, Friederike. Lymphoid Aggregates in the CNS of Progressive Multiple Sclerosis Patients Lack Regulatory T Cells. Frontiers In Immunology. 10( 32010141):3090. PubMed |