Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies






| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFG |
| Gene Sequence | EVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFG |
| Gene ID - Mouse | ENSMUSG00000035914 |
| Gene ID - Rat | ENSRNOG00000033608 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CD276 pAb (ATL-HPA017139 w/enhanced validation) | |
| Datasheet | Anti CD276 pAb (ATL-HPA017139 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD276 pAb (ATL-HPA017139 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CD276 pAb (ATL-HPA017139 w/enhanced validation) | |
| Datasheet | Anti CD276 pAb (ATL-HPA017139 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD276 pAb (ATL-HPA017139 w/enhanced validation) |
| Citations for Anti CD276 pAb (ATL-HPA017139 w/enhanced validation) – 2 Found |
| Zhang, Chaoqi; Zhang, Zhen; Li, Feng; Shen, Zhibo; Qiao, Yamin; Li, Lifeng; Liu, Shasha; Song, Mengjia; Zhao, Xuan; Ren, Feifei; He, Qianyi; Yang, Bo; Fan, Ruitai; Zhang, Yi. Large-scale analysis reveals the specific clinical and immune features of B7-H3 in glioma. Oncoimmunology. 7(11):e1461304. PubMed |
| Lemke, Dieter; Pfenning, Philipp-Niclas; Sahm, Felix; Klein, Ann-Catherine; Kempf, Tore; Warnken, Uwe; Schnölzer, Martina; Tudoran, Ruxandra; Weller, Michael; Platten, Michael; Wick, Wolfgang. Costimulatory protein 4IgB7H3 drives the malignant phenotype of glioblastoma by mediating immune escape and invasiveness. Clinical Cancer Research : An Official Journal Of The American Association For Cancer Research. 2012;18(1):105-17. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies






| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFG |
| Gene Sequence | EVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFG |
| Gene ID - Mouse | ENSMUSG00000035914 |
| Gene ID - Rat | ENSRNOG00000033608 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CD276 pAb (ATL-HPA017139 w/enhanced validation) | |
| Datasheet | Anti CD276 pAb (ATL-HPA017139 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD276 pAb (ATL-HPA017139 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CD276 pAb (ATL-HPA017139 w/enhanced validation) | |
| Datasheet | Anti CD276 pAb (ATL-HPA017139 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD276 pAb (ATL-HPA017139 w/enhanced validation) |
| Citations for Anti CD276 pAb (ATL-HPA017139 w/enhanced validation) – 2 Found |
| Zhang, Chaoqi; Zhang, Zhen; Li, Feng; Shen, Zhibo; Qiao, Yamin; Li, Lifeng; Liu, Shasha; Song, Mengjia; Zhao, Xuan; Ren, Feifei; He, Qianyi; Yang, Bo; Fan, Ruitai; Zhang, Yi. Large-scale analysis reveals the specific clinical and immune features of B7-H3 in glioma. Oncoimmunology. 7(11):e1461304. PubMed |
| Lemke, Dieter; Pfenning, Philipp-Niclas; Sahm, Felix; Klein, Ann-Catherine; Kempf, Tore; Warnken, Uwe; Schnölzer, Martina; Tudoran, Ruxandra; Weller, Michael; Platten, Michael; Wick, Wolfgang. Costimulatory protein 4IgB7H3 drives the malignant phenotype of glioblastoma by mediating immune escape and invasiveness. Clinical Cancer Research : An Official Journal Of The American Association For Cancer Research. 2012;18(1):105-17. PubMed |