Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAG |
| Gene Sequence | ATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAG |
| Gene ID - Mouse | ENSMUSG00000016494 |
| Gene ID - Rat | ENSRNOG00000045558 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CD34 pAb (ATL-HPA036722 w/enhanced validation) | |
| Datasheet | Anti CD34 pAb (ATL-HPA036722 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD34 pAb (ATL-HPA036722 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CD34 pAb (ATL-HPA036722 w/enhanced validation) | |
| Datasheet | Anti CD34 pAb (ATL-HPA036722 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD34 pAb (ATL-HPA036722 w/enhanced validation) |
| Citations for Anti CD34 pAb (ATL-HPA036722 w/enhanced validation) – 3 Found |
| Yang, Bao; Yang, Chenlong; Fang, Jingyi; Yang, Jun; Xu, Yulun. Clinicoradiological characteristics, management and prognosis of primary myeloid sarcoma of the central nervous system: A report of four cases. Oncology Letters. 2017;14(3):3825-3831. PubMed |
| Hsieh, Mei Jen; Chiu, Tai-Jan; Lin, Yu Chun; Weng, Ching-Chieh; Weng, Yu-Ting; Hsiao, Chang-Chun; Cheng, Kuang-Hung. Inactivation of APC Induces CD34 Upregulation to Promote Epithelial-Mesenchymal Transition and Cancer Stem Cell Traits in Pancreatic Cancer. International Journal Of Molecular Sciences. 2020;21(12) PubMed |
| Barad, Maya; Csukasi, Fabiana; Bosakova, Michaela; Martin, Jorge H; Zhang, Wenjuan; Paige Taylor, S; Lachman, Ralph S; Zieba, Jennifer; Bamshad, Michael; Nickerson, Deborah; Chong, Jessica X; Cohn, Daniel H; Krejci, Pavel; Krakow, Deborah; Duran, Ivan. Biallelic mutations in LAMA5 disrupts a skeletal noncanonical focal adhesion pathway and produces a distinct bent bone dysplasia. Ebiomedicine. 2020;62( 33242826):103075. PubMed |


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAG |
| Gene Sequence | ATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAG |
| Gene ID - Mouse | ENSMUSG00000016494 |
| Gene ID - Rat | ENSRNOG00000045558 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CD34 pAb (ATL-HPA036722 w/enhanced validation) | |
| Datasheet | Anti CD34 pAb (ATL-HPA036722 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD34 pAb (ATL-HPA036722 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CD34 pAb (ATL-HPA036722 w/enhanced validation) | |
| Datasheet | Anti CD34 pAb (ATL-HPA036722 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD34 pAb (ATL-HPA036722 w/enhanced validation) |
| Citations for Anti CD34 pAb (ATL-HPA036722 w/enhanced validation) – 3 Found |
| Yang, Bao; Yang, Chenlong; Fang, Jingyi; Yang, Jun; Xu, Yulun. Clinicoradiological characteristics, management and prognosis of primary myeloid sarcoma of the central nervous system: A report of four cases. Oncology Letters. 2017;14(3):3825-3831. PubMed |
| Hsieh, Mei Jen; Chiu, Tai-Jan; Lin, Yu Chun; Weng, Ching-Chieh; Weng, Yu-Ting; Hsiao, Chang-Chun; Cheng, Kuang-Hung. Inactivation of APC Induces CD34 Upregulation to Promote Epithelial-Mesenchymal Transition and Cancer Stem Cell Traits in Pancreatic Cancer. International Journal Of Molecular Sciences. 2020;21(12) PubMed |
| Barad, Maya; Csukasi, Fabiana; Bosakova, Michaela; Martin, Jorge H; Zhang, Wenjuan; Paige Taylor, S; Lachman, Ralph S; Zieba, Jennifer; Bamshad, Michael; Nickerson, Deborah; Chong, Jessica X; Cohn, Daniel H; Krejci, Pavel; Krakow, Deborah; Duran, Ivan. Biallelic mutations in LAMA5 disrupts a skeletal noncanonical focal adhesion pathway and produces a distinct bent bone dysplasia. Ebiomedicine. 2020;62( 33242826):103075. PubMed |