Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies




| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQENGTGQATSRNGHSARQHVVADTEL |
| Gene Sequence | LMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQENGTGQATSRNGHSARQHVVADTEL |
| Gene ID - Mouse | ENSMUSG00000016494 |
| Gene ID - Rat | ENSRNOG00000045558 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CD34 pAb (ATL-HPA036723 w/enhanced validation) | |
| Datasheet | Anti CD34 pAb (ATL-HPA036723 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD34 pAb (ATL-HPA036723 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CD34 pAb (ATL-HPA036723 w/enhanced validation) | |
| Datasheet | Anti CD34 pAb (ATL-HPA036723 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD34 pAb (ATL-HPA036723 w/enhanced validation) |
| Citations for Anti CD34 pAb (ATL-HPA036723 w/enhanced validation) – 3 Found |
| Spiegler, Stefanie; Rath, Matthias; Much, Christiane D; Sendtner, Barbara S; Felbor, Ute. Precise CCM1 gene correction and inactivation in patient-derived endothelial cells: Modeling Knudson's two-hit hypothesis in vitro. Molecular Genetics & Genomic Medicine. 2019;7(7):e00755. PubMed |
| Pan, Li; Lemieux, Madeleine E; Thomas, Tom; Rogers, Julia M; Lipper, Colin H; Lee, Winston; Johnson, Carl; Sholl, Lynette M; South, Andrew P; Marto, Jarrod A; Adelmant, Guillaume O; Blacklow, Stephen C; Aster, Jon C. IER5, a DNA damage response gene, is required for Notch-mediated induction of squamous cell differentiation. Elife. 2020;9( 32936072) PubMed |
| Taher, Husam; Mahyari, Eisa; Kreklywich, Craig; Uebelhoer, Luke S; McArdle, Matthew R; Moström, Matilda J; Bhusari, Amruta; Nekorchuk, Michael; E, Xiaofei; Whitmer, Travis; Scheef, Elizabeth A; Sprehe, Lesli M; Roberts, Dawn L; Hughes, Colette M; Jackson, Kerianne A; Selseth, Andrea N; Ventura, Abigail B; Cleveland-Rubeor, Hillary C; Yue, Yujuan; Schmidt, Kimberli A; Shao, Jason; Edlefsen, Paul T; Smedley, Jeremy; Kowalik, Timothy F; Stanton, Richard J; Axthelm, Michael K; Estes, Jacob D; Hansen, Scott G; Kaur, Amitinder; Barry, Peter A; Bimber, Benjamin N; Picker, Louis J; Streblow, Daniel N; Früh, Klaus; Malouli, Daniel. In vitro and in vivo characterization of a recombinant rhesus cytomegalovirus containing a complete genome. Plos Pathogens. 2020;16(11):e1008666. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies




| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQENGTGQATSRNGHSARQHVVADTEL |
| Gene Sequence | LMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQENGTGQATSRNGHSARQHVVADTEL |
| Gene ID - Mouse | ENSMUSG00000016494 |
| Gene ID - Rat | ENSRNOG00000045558 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CD34 pAb (ATL-HPA036723 w/enhanced validation) | |
| Datasheet | Anti CD34 pAb (ATL-HPA036723 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD34 pAb (ATL-HPA036723 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CD34 pAb (ATL-HPA036723 w/enhanced validation) | |
| Datasheet | Anti CD34 pAb (ATL-HPA036723 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD34 pAb (ATL-HPA036723 w/enhanced validation) |
| Citations for Anti CD34 pAb (ATL-HPA036723 w/enhanced validation) – 3 Found |
| Spiegler, Stefanie; Rath, Matthias; Much, Christiane D; Sendtner, Barbara S; Felbor, Ute. Precise CCM1 gene correction and inactivation in patient-derived endothelial cells: Modeling Knudson's two-hit hypothesis in vitro. Molecular Genetics & Genomic Medicine. 2019;7(7):e00755. PubMed |
| Pan, Li; Lemieux, Madeleine E; Thomas, Tom; Rogers, Julia M; Lipper, Colin H; Lee, Winston; Johnson, Carl; Sholl, Lynette M; South, Andrew P; Marto, Jarrod A; Adelmant, Guillaume O; Blacklow, Stephen C; Aster, Jon C. IER5, a DNA damage response gene, is required for Notch-mediated induction of squamous cell differentiation. Elife. 2020;9( 32936072) PubMed |
| Taher, Husam; Mahyari, Eisa; Kreklywich, Craig; Uebelhoer, Luke S; McArdle, Matthew R; Moström, Matilda J; Bhusari, Amruta; Nekorchuk, Michael; E, Xiaofei; Whitmer, Travis; Scheef, Elizabeth A; Sprehe, Lesli M; Roberts, Dawn L; Hughes, Colette M; Jackson, Kerianne A; Selseth, Andrea N; Ventura, Abigail B; Cleveland-Rubeor, Hillary C; Yue, Yujuan; Schmidt, Kimberli A; Shao, Jason; Edlefsen, Paul T; Smedley, Jeremy; Kowalik, Timothy F; Stanton, Richard J; Axthelm, Michael K; Estes, Jacob D; Hansen, Scott G; Kaur, Amitinder; Barry, Peter A; Bimber, Benjamin N; Picker, Louis J; Streblow, Daniel N; Früh, Klaus; Malouli, Daniel. In vitro and in vivo characterization of a recombinant rhesus cytomegalovirus containing a complete genome. Plos Pathogens. 2020;16(11):e1008666. PubMed |