Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies




| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLREL |
| Gene Sequence | VVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLREL |
| Gene ID - Mouse | ENSMUSG00000002944 |
| Gene ID - Rat | ENSRNOG00000040108 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CD36 pAb (ATL-HPA002018 w/enhanced validation) | |
| Datasheet | Anti CD36 pAb (ATL-HPA002018 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD36 pAb (ATL-HPA002018 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CD36 pAb (ATL-HPA002018 w/enhanced validation) | |
| Datasheet | Anti CD36 pAb (ATL-HPA002018 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD36 pAb (ATL-HPA002018 w/enhanced validation) |
| Citations for Anti CD36 pAb (ATL-HPA002018 w/enhanced validation) – 5 Found |
| Ladanyi, Andras; Mukherjee, Abir; Kenny, Hilary A; Johnson, Alyssa; Mitra, Anirban K; Sundaresan, Sinju; Nieman, Kristin M; Pascual, Gloria; Benitah, Salvador Aznar; Montag, Anthony; Yamada, S Diane; Abumrad, Nada A; Lengyel, Ernst. Adipocyte-induced CD36 expression drives ovarian cancer progression and metastasis. Oncogene. 2018;37(17):2285-2301. PubMed |
| Vendramin, Roberto; Katopodi, Vicky; Cinque, Sonia; Konnova, Angelina; Knezevic, Zorica; Adnane, Sara; Verheyden, Yvessa; Karras, Panagiotis; Demesmaeker, Ewout; Bosisio, Francesca M; Kucera, Lukas; Rozman, Jan; Gladwyn-Ng, Ivan; Rizzotto, Lara; Dassi, Erik; Millevoi, Stefania; Bechter, Oliver; Marine, Jean-Christophe; Leucci, Eleonora. Activation of the integrated stress response confers vulnerability to mitoribosome-targeting antibiotics in melanoma. The Journal Of Experimental Medicine. 2021;218(9) PubMed |
| Giannoni, Paolo; Narcisi, Roberto; De Totero, Daniela; Romussi, Giovanni; Quarto, Rodolfo; Bisio, Angela. The administration of demethyl fruticulin A from Salvia corrugata to mammalian cells lines induces "anoikis", a special form of apoptosis. Phytomedicine : International Journal Of Phytotherapy And Phytopharmacology. 2010;17(6):449-56. PubMed |
| Thomas, Melissa M; Trajcevski, Karin E; Coleman, Samantha K; Jiang, Maggie; Di Michele, Joseph; O'Neill, Hayley M; Lally, James S; Steinberg, Gregory R; Hawke, Thomas J. Early oxidative shifts in mouse skeletal muscle morphology with high-fat diet consumption do not lead to functional improvements. Physiological Reports. 2014;2(9) PubMed |
| Marino, Natascia; German, Rana; Rao, Xi; Simpson, Ed; Liu, Sheng; Wan, Jun; Liu, Yunlong; Sandusky, George; Jacobsen, Max; Stoval, Miranda; Cao, Sha; Storniolo, Anna Maria V. Upregulation of lipid metabolism genes in the breast prior to cancer diagnosis. Npj Breast Cancer. 6( 33083529):50. PubMed |




| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLREL |
| Gene Sequence | VVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLREL |
| Gene ID - Mouse | ENSMUSG00000002944 |
| Gene ID - Rat | ENSRNOG00000040108 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CD36 pAb (ATL-HPA002018 w/enhanced validation) | |
| Datasheet | Anti CD36 pAb (ATL-HPA002018 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD36 pAb (ATL-HPA002018 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CD36 pAb (ATL-HPA002018 w/enhanced validation) | |
| Datasheet | Anti CD36 pAb (ATL-HPA002018 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD36 pAb (ATL-HPA002018 w/enhanced validation) |
| Citations for Anti CD36 pAb (ATL-HPA002018 w/enhanced validation) – 5 Found |
| Ladanyi, Andras; Mukherjee, Abir; Kenny, Hilary A; Johnson, Alyssa; Mitra, Anirban K; Sundaresan, Sinju; Nieman, Kristin M; Pascual, Gloria; Benitah, Salvador Aznar; Montag, Anthony; Yamada, S Diane; Abumrad, Nada A; Lengyel, Ernst. Adipocyte-induced CD36 expression drives ovarian cancer progression and metastasis. Oncogene. 2018;37(17):2285-2301. PubMed |
| Vendramin, Roberto; Katopodi, Vicky; Cinque, Sonia; Konnova, Angelina; Knezevic, Zorica; Adnane, Sara; Verheyden, Yvessa; Karras, Panagiotis; Demesmaeker, Ewout; Bosisio, Francesca M; Kucera, Lukas; Rozman, Jan; Gladwyn-Ng, Ivan; Rizzotto, Lara; Dassi, Erik; Millevoi, Stefania; Bechter, Oliver; Marine, Jean-Christophe; Leucci, Eleonora. Activation of the integrated stress response confers vulnerability to mitoribosome-targeting antibiotics in melanoma. The Journal Of Experimental Medicine. 2021;218(9) PubMed |
| Giannoni, Paolo; Narcisi, Roberto; De Totero, Daniela; Romussi, Giovanni; Quarto, Rodolfo; Bisio, Angela. The administration of demethyl fruticulin A from Salvia corrugata to mammalian cells lines induces "anoikis", a special form of apoptosis. Phytomedicine : International Journal Of Phytotherapy And Phytopharmacology. 2010;17(6):449-56. PubMed |
| Thomas, Melissa M; Trajcevski, Karin E; Coleman, Samantha K; Jiang, Maggie; Di Michele, Joseph; O'Neill, Hayley M; Lally, James S; Steinberg, Gregory R; Hawke, Thomas J. Early oxidative shifts in mouse skeletal muscle morphology with high-fat diet consumption do not lead to functional improvements. Physiological Reports. 2014;2(9) PubMed |
| Marino, Natascia; German, Rana; Rao, Xi; Simpson, Ed; Liu, Sheng; Wan, Jun; Liu, Yunlong; Sandusky, George; Jacobsen, Max; Stoval, Miranda; Cao, Sha; Storniolo, Anna Maria V. Upregulation of lipid metabolism genes in the breast prior to cancer diagnosis. Npj Breast Cancer. 6( 33083529):50. PubMed |