Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies






| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | CYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGG |
| Gene Sequence | CYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGG |
| Gene ID - Mouse | ENSMUSG00000068686 |
| Gene ID - Rat | ENSRNOG00000042821 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CD59 pAb (ATL-HPA026494 w/enhanced validation) | |
| Datasheet | Anti CD59 pAb (ATL-HPA026494 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD59 pAb (ATL-HPA026494 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CD59 pAb (ATL-HPA026494 w/enhanced validation) | |
| Datasheet | Anti CD59 pAb (ATL-HPA026494 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD59 pAb (ATL-HPA026494 w/enhanced validation) |
| Citations for Anti CD59 pAb (ATL-HPA026494 w/enhanced validation) – 2 Found |
| Cheng, L; Gou, S-J; Qiu, H-Y; Ma, L; Fu, P. Complement regulatory proteins in kidneys of patients with anti-neutrophil cytoplasmic antibody (ANCA)-associated vasculitis. Clinical And Experimental Immunology. 2018;191(1):116-124. PubMed |
| Zhang, Ronghua; Liu, Qiaofei; Peng, Junya; Wang, Mengyi; Gao, Xiang; Liao, Quan; Zhao, Yupei. Pancreatic cancer-educated macrophages protect cancer cells from complement-dependent cytotoxicity by up-regulation of CD59. Cell Death & Disease. 2019;10(11):836. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies






| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | CYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGG |
| Gene Sequence | CYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGG |
| Gene ID - Mouse | ENSMUSG00000068686 |
| Gene ID - Rat | ENSRNOG00000042821 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CD59 pAb (ATL-HPA026494 w/enhanced validation) | |
| Datasheet | Anti CD59 pAb (ATL-HPA026494 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD59 pAb (ATL-HPA026494 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CD59 pAb (ATL-HPA026494 w/enhanced validation) | |
| Datasheet | Anti CD59 pAb (ATL-HPA026494 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD59 pAb (ATL-HPA026494 w/enhanced validation) |
| Citations for Anti CD59 pAb (ATL-HPA026494 w/enhanced validation) – 2 Found |
| Cheng, L; Gou, S-J; Qiu, H-Y; Ma, L; Fu, P. Complement regulatory proteins in kidneys of patients with anti-neutrophil cytoplasmic antibody (ANCA)-associated vasculitis. Clinical And Experimental Immunology. 2018;191(1):116-124. PubMed |
| Zhang, Ronghua; Liu, Qiaofei; Peng, Junya; Wang, Mengyi; Gao, Xiang; Liao, Quan; Zhao, Yupei. Pancreatic cancer-educated macrophages protect cancer cells from complement-dependent cytotoxicity by up-regulation of CD59. Cell Death & Disease. 2019;10(11):836. PubMed |