Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSE |
| Gene Sequence | VGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSE |
| Gene ID - Mouse | ENSMUSG00000030156 |
| Gene ID - Rat | ENSRNOG00000056783 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CD69 pAb (ATL-HPA050525 w/enhanced validation) | |
| Datasheet | Anti CD69 pAb (ATL-HPA050525 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD69 pAb (ATL-HPA050525 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CD69 pAb (ATL-HPA050525 w/enhanced validation) | |
| Datasheet | Anti CD69 pAb (ATL-HPA050525 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD69 pAb (ATL-HPA050525 w/enhanced validation) |
| Citations for Anti CD69 pAb (ATL-HPA050525 w/enhanced validation) – 2 Found |
| Chang, Margaret H; Levescot, Anaïs; Nelson-Maney, Nathan; Blaustein, Rachel B; Winden, Kellen D; Morris, Allyn; Wactor, Alexandra; Balu, Spoorthi; Grieshaber-Bouyer, Ricardo; Wei, Kevin; Henderson, Lauren A; Iwakura, Yoichiro; Clark, Rachael A; Rao, Deepak A; Fuhlbrigge, Robert C; Nigrovic, Peter A. Arthritis flares mediated by tissue-resident memory T cells in the joint. Cell Reports. 2021;37(4):109902. PubMed |
| Griss, Johannes; Bauer, Wolfgang; Wagner, Christine; Simon, Martin; Chen, Minyi; Grabmeier-Pfistershammer, Katharina; Maurer-Granofszky, Margarita; Roka, Florian; Penz, Thomas; Bock, Christoph; Zhang, Gao; Herlyn, Meenhard; Glatz, Katharina; Läubli, Heinz; Mertz, Kirsten D; Petzelbauer, Peter; Wiesner, Thomas; Hartl, Markus; Pickl, Winfried F; Somasundaram, Rajasekharan; Steinberger, Peter; Wagner, Stephan N. B cells sustain inflammation and predict response to immune checkpoint blockade in human melanoma. Nature Communications. 2019;10(1):4186. PubMed |


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSE |
| Gene Sequence | VGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSE |
| Gene ID - Mouse | ENSMUSG00000030156 |
| Gene ID - Rat | ENSRNOG00000056783 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CD69 pAb (ATL-HPA050525 w/enhanced validation) | |
| Datasheet | Anti CD69 pAb (ATL-HPA050525 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD69 pAb (ATL-HPA050525 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CD69 pAb (ATL-HPA050525 w/enhanced validation) | |
| Datasheet | Anti CD69 pAb (ATL-HPA050525 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD69 pAb (ATL-HPA050525 w/enhanced validation) |
| Citations for Anti CD69 pAb (ATL-HPA050525 w/enhanced validation) – 2 Found |
| Chang, Margaret H; Levescot, Anaïs; Nelson-Maney, Nathan; Blaustein, Rachel B; Winden, Kellen D; Morris, Allyn; Wactor, Alexandra; Balu, Spoorthi; Grieshaber-Bouyer, Ricardo; Wei, Kevin; Henderson, Lauren A; Iwakura, Yoichiro; Clark, Rachael A; Rao, Deepak A; Fuhlbrigge, Robert C; Nigrovic, Peter A. Arthritis flares mediated by tissue-resident memory T cells in the joint. Cell Reports. 2021;37(4):109902. PubMed |
| Griss, Johannes; Bauer, Wolfgang; Wagner, Christine; Simon, Martin; Chen, Minyi; Grabmeier-Pfistershammer, Katharina; Maurer-Granofszky, Margarita; Roka, Florian; Penz, Thomas; Bock, Christoph; Zhang, Gao; Herlyn, Meenhard; Glatz, Katharina; Läubli, Heinz; Mertz, Kirsten D; Petzelbauer, Peter; Wiesner, Thomas; Hartl, Markus; Pickl, Winfried F; Somasundaram, Rajasekharan; Steinberger, Peter; Wagner, Stephan N. B cells sustain inflammation and predict response to immune checkpoint blockade in human melanoma. Nature Communications. 2019;10(1):4186. PubMed |