Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/45592/25899/atl-hpa022821_anti-cdc42bpb-pab-atl-hpa022821_36710__62282.1783628785.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KSKFSGAVLNVPDTSDNSKKQMLRTRSKRRFVFKVPEEERLQQRREMLRDPELRSKMISNPTNFNHVAHMGPGDGMQVLMDLPLSAVPPSQEERPGPAPTNLARQPPSRNKPYISWPSSGGSEPSVTVPLRSMSDPDQDFDKEPDSDST |
| Gene Sequence | KSKFSGAVLNVPDTSDNSKKQMLRTRSKRRFVFKVPEEERLQQRREMLRDPELRSKMISNPTNFNHVAHMGPGDGMQVLMDLPLSAVPPSQEERPGPAPTNLARQPPSRNKPYISWPSSGGSEPSVTVPLRSMSDPDQDFDKEPDSDST |
| Gene ID - Mouse | ENSMUSG00000021279 |
| Gene ID - Rat | ENSRNOG00000009675 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CDC42BPB pAb (ATL-HPA022821) | |
| Datasheet | Anti CDC42BPB pAb (ATL-HPA022821) Datasheet (External Link) |
| Vendor Page | Anti CDC42BPB pAb (ATL-HPA022821) at Atlas Antibodies |
| Documents & Links for Anti CDC42BPB pAb (ATL-HPA022821) | |
| Datasheet | Anti CDC42BPB pAb (ATL-HPA022821) Datasheet (External Link) |
| Vendor Page | Anti CDC42BPB pAb (ATL-HPA022821) |
| Citations for Anti CDC42BPB pAb (ATL-HPA022821) – 1 Found |
| Unbekandt, Mathieu; Belshaw, Simone; Bower, Justin; Clarke, Maeve; Cordes, Jacqueline; Crighton, Diane; Croft, Daniel R; Drysdale, Martin J; Garnett, Mathew J; Gill, Kathryn; Gray, Christopher; Greenhalgh, David A; Hall, James A M; Konczal, Jennifer; Lilla, Sergio; McArthur, Duncan; McConnell, Patricia; McDonald, Laura; McGarry, Lynn; McKinnon, Heather; McMenemy, Carol; Mezna, Mokdad; Morrice, Nicolas A; Munro, June; Naylor, Gregory; Rath, Nicola; Schüttelkopf, Alexander W; Sime, Mairi; Olson, Michael F. Discovery of Potent and Selective MRCK Inhibitors with Therapeutic Effect on Skin Cancer. Cancer Research. 2018;78(8):2096-2114. PubMed |
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KSKFSGAVLNVPDTSDNSKKQMLRTRSKRRFVFKVPEEERLQQRREMLRDPELRSKMISNPTNFNHVAHMGPGDGMQVLMDLPLSAVPPSQEERPGPAPTNLARQPPSRNKPYISWPSSGGSEPSVTVPLRSMSDPDQDFDKEPDSDST |
| Gene Sequence | KSKFSGAVLNVPDTSDNSKKQMLRTRSKRRFVFKVPEEERLQQRREMLRDPELRSKMISNPTNFNHVAHMGPGDGMQVLMDLPLSAVPPSQEERPGPAPTNLARQPPSRNKPYISWPSSGGSEPSVTVPLRSMSDPDQDFDKEPDSDST |
| Gene ID - Mouse | ENSMUSG00000021279 |
| Gene ID - Rat | ENSRNOG00000009675 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CDC42BPB pAb (ATL-HPA022821) | |
| Datasheet | Anti CDC42BPB pAb (ATL-HPA022821) Datasheet (External Link) |
| Vendor Page | Anti CDC42BPB pAb (ATL-HPA022821) at Atlas Antibodies |
| Documents & Links for Anti CDC42BPB pAb (ATL-HPA022821) | |
| Datasheet | Anti CDC42BPB pAb (ATL-HPA022821) Datasheet (External Link) |
| Vendor Page | Anti CDC42BPB pAb (ATL-HPA022821) |
| Citations for Anti CDC42BPB pAb (ATL-HPA022821) – 1 Found |
| Unbekandt, Mathieu; Belshaw, Simone; Bower, Justin; Clarke, Maeve; Cordes, Jacqueline; Crighton, Diane; Croft, Daniel R; Drysdale, Martin J; Garnett, Mathew J; Gill, Kathryn; Gray, Christopher; Greenhalgh, David A; Hall, James A M; Konczal, Jennifer; Lilla, Sergio; McArthur, Duncan; McConnell, Patricia; McDonald, Laura; McGarry, Lynn; McKinnon, Heather; McMenemy, Carol; Mezna, Mokdad; Morrice, Nicolas A; Munro, June; Naylor, Gregory; Rath, Nicola; Schüttelkopf, Alexander W; Sime, Mairi; Olson, Michael F. Discovery of Potent and Selective MRCK Inhibitors with Therapeutic Effect on Skin Cancer. Cancer Research. 2018;78(8):2096-2114. PubMed |