Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
![Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human cell line U-251 MG](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/47352/29193/atl-hpa028783_anti-cdca8-pab-atl-hpa028783-wenhanced-validation_40083__24593.1783631200.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LRTPAAGERIYNISGNGSPLADSKEIFLTVPVGGGESLRLLASDLQRHSIAQLDPEALGNIKKLSNRLAQICSSIRTHK |
| Gene Sequence | LRTPAAGERIYNISGNGSPLADSKEIFLTVPVGGGESLRLLASDLQRHSIAQLDPEALGNIKKLSNRLAQICSSIRTHK |
| Gene ID - Mouse | ENSMUSG00000028873 |
| Gene ID - Rat | ENSRNOG00000031431 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CDCA8 pAb (ATL-HPA028783 w/enhanced validation) | |
| Datasheet | Anti CDCA8 pAb (ATL-HPA028783 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CDCA8 pAb (ATL-HPA028783 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CDCA8 pAb (ATL-HPA028783 w/enhanced validation) | |
| Datasheet | Anti CDCA8 pAb (ATL-HPA028783 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CDCA8 pAb (ATL-HPA028783 w/enhanced validation) |
| Citations for Anti CDCA8 pAb (ATL-HPA028783 w/enhanced validation) – 1 Found |
| Shen, Peilin; He, Xuejun; Lan, Lin; Hong, Yingkai; Lin, Mingen. Identification of cell division cycle 20 as a candidate biomarker and potential therapeutic target in bladder cancer using bioinformatics analysis. Bioscience Reports. 2020;40(7) PubMed |
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LRTPAAGERIYNISGNGSPLADSKEIFLTVPVGGGESLRLLASDLQRHSIAQLDPEALGNIKKLSNRLAQICSSIRTHK |
| Gene Sequence | LRTPAAGERIYNISGNGSPLADSKEIFLTVPVGGGESLRLLASDLQRHSIAQLDPEALGNIKKLSNRLAQICSSIRTHK |
| Gene ID - Mouse | ENSMUSG00000028873 |
| Gene ID - Rat | ENSRNOG00000031431 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CDCA8 pAb (ATL-HPA028783 w/enhanced validation) | |
| Datasheet | Anti CDCA8 pAb (ATL-HPA028783 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CDCA8 pAb (ATL-HPA028783 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CDCA8 pAb (ATL-HPA028783 w/enhanced validation) | |
| Datasheet | Anti CDCA8 pAb (ATL-HPA028783 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CDCA8 pAb (ATL-HPA028783 w/enhanced validation) |
| Citations for Anti CDCA8 pAb (ATL-HPA028783 w/enhanced validation) – 1 Found |
| Shen, Peilin; He, Xuejun; Lan, Lin; Hong, Yingkai; Lin, Mingen. Identification of cell division cycle 20 as a candidate biomarker and potential therapeutic target in bladder cancer using bioinformatics analysis. Bioscience Reports. 2020;40(7) PubMed |