Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LDRETLLWHNITVIATEINNPKQSSRVPLYIKVLDVNDNAPEFAEFYETFVCEKAKADQLIQTLHAVDKDDPYSGHQFSFSLAPEAASGSNFTIQDNKDNTAGILTRKNGYNRHEMSTYLLP |
| Gene Sequence | LDRETLLWHNITVIATEINNPKQSSRVPLYIKVLDVNDNAPEFAEFYETFVCEKAKADQLIQTLHAVDKDDPYSGHQFSFSLAPEAASGSNFTIQDNKDNTAGILTRKNGYNRHEMSTYLLP |
| Gene ID - Mouse | ENSMUSG00000039385 |
| Gene ID - Rat | ENSRNOG00000013535 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CDH6 pAb (ATL-HPA007047 w/enhanced validation) | |
| Datasheet | Anti CDH6 pAb (ATL-HPA007047 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CDH6 pAb (ATL-HPA007047 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CDH6 pAb (ATL-HPA007047 w/enhanced validation) | |
| Datasheet | Anti CDH6 pAb (ATL-HPA007047 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CDH6 pAb (ATL-HPA007047 w/enhanced validation) |
| Citations for Anti CDH6 pAb (ATL-HPA007047 w/enhanced validation) – 4 Found |
| Marable, Sierra S; Chung, Eunah; Park, Joo-Seop. Hnf4a Is Required for the Development of Cdh6-Expressing Progenitors into Proximal Tubules in the Mouse Kidney. Journal Of The American Society Of Nephrology : Jasn. 2020;31(11):2543-2558. PubMed |
| Sancisi, Valentina; Gandolfi, Greta; Ragazzi, Moira; Nicoli, Davide; Tamagnini, Ione; Piana, Simonetta; Ciarrocchi, Alessia. Cadherin 6 is a new RUNX2 target in TGF-β signalling pathway. Plos One. 8(9):e75489. PubMed |
| Takasato, M; Er, P X; Becroft, M; Vanslambrouck, J M; Stanley, E G; Elefanty, A G; Little, M H. Directing human embryonic stem cell differentiation towards a renal lineage generates a self-organizing kidney. Nature Cell Biology. 2014;16(1):118-26. PubMed |
| Deacon, Patrick; Concodora, Charles W; Chung, Eunah; Park, Joo-Seop. β-catenin regulates the formation of multiple nephron segments in the mouse kidney. Scientific Reports. 2019;9(1):15915. PubMed |


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LDRETLLWHNITVIATEINNPKQSSRVPLYIKVLDVNDNAPEFAEFYETFVCEKAKADQLIQTLHAVDKDDPYSGHQFSFSLAPEAASGSNFTIQDNKDNTAGILTRKNGYNRHEMSTYLLP |
| Gene Sequence | LDRETLLWHNITVIATEINNPKQSSRVPLYIKVLDVNDNAPEFAEFYETFVCEKAKADQLIQTLHAVDKDDPYSGHQFSFSLAPEAASGSNFTIQDNKDNTAGILTRKNGYNRHEMSTYLLP |
| Gene ID - Mouse | ENSMUSG00000039385 |
| Gene ID - Rat | ENSRNOG00000013535 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CDH6 pAb (ATL-HPA007047 w/enhanced validation) | |
| Datasheet | Anti CDH6 pAb (ATL-HPA007047 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CDH6 pAb (ATL-HPA007047 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CDH6 pAb (ATL-HPA007047 w/enhanced validation) | |
| Datasheet | Anti CDH6 pAb (ATL-HPA007047 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CDH6 pAb (ATL-HPA007047 w/enhanced validation) |
| Citations for Anti CDH6 pAb (ATL-HPA007047 w/enhanced validation) – 4 Found |
| Marable, Sierra S; Chung, Eunah; Park, Joo-Seop. Hnf4a Is Required for the Development of Cdh6-Expressing Progenitors into Proximal Tubules in the Mouse Kidney. Journal Of The American Society Of Nephrology : Jasn. 2020;31(11):2543-2558. PubMed |
| Sancisi, Valentina; Gandolfi, Greta; Ragazzi, Moira; Nicoli, Davide; Tamagnini, Ione; Piana, Simonetta; Ciarrocchi, Alessia. Cadherin 6 is a new RUNX2 target in TGF-β signalling pathway. Plos One. 8(9):e75489. PubMed |
| Takasato, M; Er, P X; Becroft, M; Vanslambrouck, J M; Stanley, E G; Elefanty, A G; Little, M H. Directing human embryonic stem cell differentiation towards a renal lineage generates a self-organizing kidney. Nature Cell Biology. 2014;16(1):118-26. PubMed |
| Deacon, Patrick; Concodora, Charles W; Chung, Eunah; Park, Joo-Seop. β-catenin regulates the formation of multiple nephron segments in the mouse kidney. Scientific Reports. 2019;9(1):15915. PubMed |