Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LDSTLQGTYQVTVQARDRPSLGPFLEATTTLNLFTVDQSYRSRLQFSTPKEEVGANRQAINAALTQATRTTVYIVDIQDIDSAARARPHSYLDAYFVFPNGSALTLDELSVMIRNDQDSLTQLLQLGLVVLGSQESQESDLSKQLISV |
| Gene Sequence | LDSTLQGTYQVTVQARDRPSLGPFLEATTTLNLFTVDQSYRSRLQFSTPKEEVGANRQAINAALTQATRTTVYIVDIQDIDSAARARPHSYLDAYFVFPNGSALTLDELSVMIRNDQDSLTQLLQLGLVVLGSQESQESDLSKQLISV |
| Gene ID - Mouse | ENSMUSG00000034918 |
| Gene ID - Rat | ENSRNOG00000017917 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CDHR2 pAb (ATL-HPA012569) | |
| Datasheet | Anti CDHR2 pAb (ATL-HPA012569) Datasheet (External Link) |
| Vendor Page | Anti CDHR2 pAb (ATL-HPA012569) at Atlas Antibodies |
| Documents & Links for Anti CDHR2 pAb (ATL-HPA012569) | |
| Datasheet | Anti CDHR2 pAb (ATL-HPA012569) Datasheet (External Link) |
| Vendor Page | Anti CDHR2 pAb (ATL-HPA012569) |
| Citations for Anti CDHR2 pAb (ATL-HPA012569) – 5 Found |
| Li, Jianchao; He, Yunyun; Weck, Meredith L; Lu, Qing; Tyska, Matthew J; Zhang, Mingjie. Structure of Myo7b/USH1C complex suggests a general PDZ domain binding mode by MyTH4-FERM myosins. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2017;114(19):E3776-E3785. PubMed |
| Pinette, Julia A; Mao, Suli; Millis, Bryan A; Krystofiak, Evan S; Faust, James J; Tyska, Matthew J. Brush border protocadherin CDHR2 promotes the elongation and maximized packing of microvilli in vivo. Molecular Biology Of The Cell. 2019;30(1):108-118. PubMed |
| Graves, Maura J; Matoo, Samaneh; Choi, Myoung Soo; Storad, Zachary A; El Sheikh Idris, Rawnag A; Pickles, Brooke K; Acharya, Prashun; Shinder, Paula E; Arvay, Taylen O; Crawley, Scott W. A cryptic sequence targets the adhesion complex scaffold ANKS4B to apical microvilli to promote enterocyte brush border assembly. The Journal Of Biological Chemistry. 2020;295(36):12588-12604. PubMed |
| McConnell, Russell E; Benesh, Andrew E; Mao, Suli; Tabb, David L; Tyska, Matthew J. Proteomic analysis of the enterocyte brush border. American Journal Of Physiology. Gastrointestinal And Liver Physiology. 2011;300(5):G914-26. PubMed |
| Weck, Meredith L; Crawley, Scott W; Tyska, Matthew J. A heterologous in-cell assay for investigating intermicrovillar adhesion complex interactions reveals a novel protrusion length-matching mechanism. The Journal Of Biological Chemistry. 2020;295(48):16191-16206. PubMed |
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LDSTLQGTYQVTVQARDRPSLGPFLEATTTLNLFTVDQSYRSRLQFSTPKEEVGANRQAINAALTQATRTTVYIVDIQDIDSAARARPHSYLDAYFVFPNGSALTLDELSVMIRNDQDSLTQLLQLGLVVLGSQESQESDLSKQLISV |
| Gene Sequence | LDSTLQGTYQVTVQARDRPSLGPFLEATTTLNLFTVDQSYRSRLQFSTPKEEVGANRQAINAALTQATRTTVYIVDIQDIDSAARARPHSYLDAYFVFPNGSALTLDELSVMIRNDQDSLTQLLQLGLVVLGSQESQESDLSKQLISV |
| Gene ID - Mouse | ENSMUSG00000034918 |
| Gene ID - Rat | ENSRNOG00000017917 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CDHR2 pAb (ATL-HPA012569) | |
| Datasheet | Anti CDHR2 pAb (ATL-HPA012569) Datasheet (External Link) |
| Vendor Page | Anti CDHR2 pAb (ATL-HPA012569) at Atlas Antibodies |
| Documents & Links for Anti CDHR2 pAb (ATL-HPA012569) | |
| Datasheet | Anti CDHR2 pAb (ATL-HPA012569) Datasheet (External Link) |
| Vendor Page | Anti CDHR2 pAb (ATL-HPA012569) |
| Citations for Anti CDHR2 pAb (ATL-HPA012569) – 5 Found |
| Li, Jianchao; He, Yunyun; Weck, Meredith L; Lu, Qing; Tyska, Matthew J; Zhang, Mingjie. Structure of Myo7b/USH1C complex suggests a general PDZ domain binding mode by MyTH4-FERM myosins. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2017;114(19):E3776-E3785. PubMed |
| Pinette, Julia A; Mao, Suli; Millis, Bryan A; Krystofiak, Evan S; Faust, James J; Tyska, Matthew J. Brush border protocadherin CDHR2 promotes the elongation and maximized packing of microvilli in vivo. Molecular Biology Of The Cell. 2019;30(1):108-118. PubMed |
| Graves, Maura J; Matoo, Samaneh; Choi, Myoung Soo; Storad, Zachary A; El Sheikh Idris, Rawnag A; Pickles, Brooke K; Acharya, Prashun; Shinder, Paula E; Arvay, Taylen O; Crawley, Scott W. A cryptic sequence targets the adhesion complex scaffold ANKS4B to apical microvilli to promote enterocyte brush border assembly. The Journal Of Biological Chemistry. 2020;295(36):12588-12604. PubMed |
| McConnell, Russell E; Benesh, Andrew E; Mao, Suli; Tabb, David L; Tyska, Matthew J. Proteomic analysis of the enterocyte brush border. American Journal Of Physiology. Gastrointestinal And Liver Physiology. 2011;300(5):G914-26. PubMed |
| Weck, Meredith L; Crawley, Scott W; Tyska, Matthew J. A heterologous in-cell assay for investigating intermicrovillar adhesion complex interactions reveals a novel protrusion length-matching mechanism. The Journal Of Biological Chemistry. 2020;295(48):16191-16206. PubMed |