Loading...
Loading...
Loading...
Loading...
Atlas Antibodies

![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/46844/28269/atl-hpa027379_anti-cdk20-pab-atl-hpa027379-wenhanced-validation_39133__97086.1783630534.jpg?compression=lossy)

![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/46844/28269/atl-hpa027379_anti-cdk20-pab-atl-hpa027379-wenhanced-validation_39133__97086.1783630534.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LLHQYFFTAPLPAHPSELPIPQRLGGPAPKAHPGPPHIHDFHVDRPLEESLLNPELIRPFILE |
| Gene Sequence | LLHQYFFTAPLPAHPSELPIPQRLGGPAPKAHPGPPHIHDFHVDRPLEESLLNPELIRPFILE |
| Gene ID - Mouse | ENSMUSG00000021483 |
| Gene ID - Rat | ENSRNOG00000017991 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CDK20 pAb (ATL-HPA027379 w/enhanced validation) | |
| Datasheet | Anti CDK20 pAb (ATL-HPA027379 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CDK20 pAb (ATL-HPA027379 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CDK20 pAb (ATL-HPA027379 w/enhanced validation) | |
| Datasheet | Anti CDK20 pAb (ATL-HPA027379 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CDK20 pAb (ATL-HPA027379 w/enhanced validation) |
Try browsing our complete catalog of products.
Atlas Antibodies

![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/46844/28269/atl-hpa027379_anti-cdk20-pab-atl-hpa027379-wenhanced-validation_39133__97086.1783630534.jpg?compression=lossy)

![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/46844/28269/atl-hpa027379_anti-cdk20-pab-atl-hpa027379-wenhanced-validation_39133__97086.1783630534.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LLHQYFFTAPLPAHPSELPIPQRLGGPAPKAHPGPPHIHDFHVDRPLEESLLNPELIRPFILE |
| Gene Sequence | LLHQYFFTAPLPAHPSELPIPQRLGGPAPKAHPGPPHIHDFHVDRPLEESLLNPELIRPFILE |
| Gene ID - Mouse | ENSMUSG00000021483 |
| Gene ID - Rat | ENSRNOG00000017991 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CDK20 pAb (ATL-HPA027379 w/enhanced validation) | |
| Datasheet | Anti CDK20 pAb (ATL-HPA027379 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CDK20 pAb (ATL-HPA027379 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CDK20 pAb (ATL-HPA027379 w/enhanced validation) | |
| Datasheet | Anti CDK20 pAb (ATL-HPA027379 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CDK20 pAb (ATL-HPA027379 w/enhanced validation) |
No reviews have been added for this product.