Related products

No related products found

Try browsing our complete catalog of products.

Reviews 0

No reviews have been added for this product.

Reviews

Protein Description: CDK5 regulatory subunit associated protein 3
Gene Name: CDK5RAP3
Alternative Gene Name: C53, FLJ13660, HSF-27, IC53, LZAP, MST016, OK/SW-cl.114
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018669: 94%, ENSRNOG00000048747: 90%
Entrez Gene ID: 80279
Uniprot ID: Q96JB5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application	WB, ICC, IHC
Reactivity	Human, Mouse, Rat
Clonality	Polyclonal
Host	Rabbit
Immunogen	LIGKLTSLQLQHLFMILASPRYVDRVTEFLQQKLKQSQLLALKKELMVQKQQEALEEQAALEPKLDLLLEKTKELQKLIEADISKRYSGRPVNLMGTSL
Gene Sequence	LIGKLTSLQLQHLFMILASPRYVDRVTEFLQQKLKQSQLLALKKELMVQKQQEALEEQAALEPKLDLLLEKTKELQKLIEADISKRYSGRPVNLMGTSL
Gene ID - Mouse	ENSMUSG00000018669
Gene ID - Rat	ENSRNOG00000048747
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CDK5RAP3 pAb (ATL-HPA022141 w/enhanced validation)
Datasheet	Anti CDK5RAP3 pAb (ATL-HPA022141 w/enhanced validation) Datasheet (External Link)
Vendor Page	Anti CDK5RAP3 pAb (ATL-HPA022141 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CDK5RAP3 pAb (ATL-HPA022141 w/enhanced validation)
Datasheet	Anti CDK5RAP3 pAb (ATL-HPA022141 w/enhanced validation) Datasheet (External Link)
Vendor Page	Anti CDK5RAP3 pAb (ATL-HPA022141 w/enhanced validation)

Citations for Anti CDK5RAP3 pAb (ATL-HPA022141 w/enhanced validation) – 2 Found

Wamsley, J J; Gary, C; Biktasova, A; Hajek, M; Bellinger, G; Virk, R; Issaeva, N; Yarbrough, W G. Loss of LZAP inactivates p53 and regulates sensitivity of cells to DNA damage in a p53-dependent manner. Oncogenesis. 2017;6(4):e314. PubMed

Klebanovych, Anastasiya; Vinopal, Stanislav; Dráberová, Eduarda; Sládková, Vladimíra; Sulimenko, Tetyana; Sulimenko, Vadym; Vosecká, Věra; Macůrek, Libor; Legido, Agustin; Dráber, Pavel. C53 Interacting with UFM1-Protein Ligase 1 Regulates Microtubule Nucleation in Response to ER Stress. Cells. 2022;11(3) PubMed

No related products found

Reviews 0

Reviews

Anti CDK5RAP3 pAb (ATL-HPA022141 w/enhanced validation)

Additional information

Anti CDK5RAP3 pAb (ATL-HPA022141 w/enhanced validation)

Additional information

Specifications

No related products found

Reviews 0

Anti CDK5RAP3 pAb (ATL-HPA022141 w/enhanced validation)

Additional information

Specifications

Anti CDK5RAP3 pAb (ATL-HPA022141 w/enhanced validation)

Additional information

Specifications

Specifications