Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/53272/39812/atl-hpa044587_anti-cdnf-pab-atl-hpa044587_51028__11243.1783638636.jpg?compression=lossy)

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/53272/39812/atl-hpa044587_anti-cdnf-pab-atl-hpa044587_51028__11243.1783638636.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATH |
| Gene Sequence | TLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATH |
| Gene ID - Mouse | ENSMUSG00000039496 |
| Gene ID - Rat | ENSRNOG00000026493 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CDNF pAb (ATL-HPA044587) | |
| Datasheet | Anti CDNF pAb (ATL-HPA044587) Datasheet (External Link) |
| Vendor Page | Anti CDNF pAb (ATL-HPA044587) at Atlas Antibodies |
| Documents & Links for Anti CDNF pAb (ATL-HPA044587) | |
| Datasheet | Anti CDNF pAb (ATL-HPA044587) Datasheet (External Link) |
| Vendor Page | Anti CDNF pAb (ATL-HPA044587) |
| Citations for Anti CDNF pAb (ATL-HPA044587) – 1 Found |
| Tseng, Kuan-Yin; Stratoulias, Vassilis; Hu, Wei-Fen; Wu, Jui-Sheng; Wang, Vicki; Chen, Yuan-Hao; Seelbach, Anna; Huttunen, Henri J; Kulesskaya, Natalia; Pang, Cheng-Yoong; Chou, Jian-Liang; Lindahl, Maria; Saarma, Mart; Huang, Li-Chuan; Airavaara, Mikko; Liew, Hock-Kean. Augmenting hematoma-scavenging capacity of innate immune cells by CDNF reduces brain injury and promotes functional recovery after intracerebral hemorrhage. Cell Death & Disease. 2023;14(2):128. PubMed |

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/53272/39812/atl-hpa044587_anti-cdnf-pab-atl-hpa044587_51028__11243.1783638636.jpg?compression=lossy)

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/53272/39812/atl-hpa044587_anti-cdnf-pab-atl-hpa044587_51028__11243.1783638636.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATH |
| Gene Sequence | TLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATH |
| Gene ID - Mouse | ENSMUSG00000039496 |
| Gene ID - Rat | ENSRNOG00000026493 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CDNF pAb (ATL-HPA044587) | |
| Datasheet | Anti CDNF pAb (ATL-HPA044587) Datasheet (External Link) |
| Vendor Page | Anti CDNF pAb (ATL-HPA044587) at Atlas Antibodies |
| Documents & Links for Anti CDNF pAb (ATL-HPA044587) | |
| Datasheet | Anti CDNF pAb (ATL-HPA044587) Datasheet (External Link) |
| Vendor Page | Anti CDNF pAb (ATL-HPA044587) |
| Citations for Anti CDNF pAb (ATL-HPA044587) – 1 Found |
| Tseng, Kuan-Yin; Stratoulias, Vassilis; Hu, Wei-Fen; Wu, Jui-Sheng; Wang, Vicki; Chen, Yuan-Hao; Seelbach, Anna; Huttunen, Henri J; Kulesskaya, Natalia; Pang, Cheng-Yoong; Chou, Jian-Liang; Lindahl, Maria; Saarma, Mart; Huang, Li-Chuan; Airavaara, Mikko; Liew, Hock-Kean. Augmenting hematoma-scavenging capacity of innate immune cells by CDNF reduces brain injury and promotes functional recovery after intracerebral hemorrhage. Cell Death & Disease. 2023;14(2):128. PubMed |