Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SALPTNDNSYRGILNPSQPGQSSSSSQTFGVSSSGQSVSSNQRPCSSDIPDSPCSGGPIVSHSGPYIPSSHSVSGGQRPVVVVVDQHGSGAPG |
| Gene Sequence | SALPTNDNSYRGILNPSQPGQSSSSSQTFGVSSSGQSVSSNQRPCSSDIPDSPCSGGPIVSHSGPYIPSSHSVSGGQRPVVVVVDQHGSGAPG |
| Gene ID - Mouse | ENSMUSG00000039518 |
| Gene ID - Rat | ENSRNOG00000005934 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CDSN pAb (ATL-HPA044730 w/enhanced validation) | |
| Datasheet | Anti CDSN pAb (ATL-HPA044730 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CDSN pAb (ATL-HPA044730 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CDSN pAb (ATL-HPA044730 w/enhanced validation) | |
| Datasheet | Anti CDSN pAb (ATL-HPA044730 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CDSN pAb (ATL-HPA044730 w/enhanced validation) |
| Citations for Anti CDSN pAb (ATL-HPA044730 w/enhanced validation) – 1 Found |
| Narda, Mridvika; Trullas, Carles; Brown, Anthony; Piquero-Casals, Jaime; Granger, Corinne; Fabbrocini, Gabriella. Glycolic acid adjusted to pH 4 stimulates collagen production and epidermal renewal without affecting levels of proinflammatory TNF-alpha in human skin explants. Journal Of Cosmetic Dermatology. 2021;20(2):513-521. PubMed |
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SALPTNDNSYRGILNPSQPGQSSSSSQTFGVSSSGQSVSSNQRPCSSDIPDSPCSGGPIVSHSGPYIPSSHSVSGGQRPVVVVVDQHGSGAPG |
| Gene Sequence | SALPTNDNSYRGILNPSQPGQSSSSSQTFGVSSSGQSVSSNQRPCSSDIPDSPCSGGPIVSHSGPYIPSSHSVSGGQRPVVVVVDQHGSGAPG |
| Gene ID - Mouse | ENSMUSG00000039518 |
| Gene ID - Rat | ENSRNOG00000005934 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CDSN pAb (ATL-HPA044730 w/enhanced validation) | |
| Datasheet | Anti CDSN pAb (ATL-HPA044730 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CDSN pAb (ATL-HPA044730 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CDSN pAb (ATL-HPA044730 w/enhanced validation) | |
| Datasheet | Anti CDSN pAb (ATL-HPA044730 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CDSN pAb (ATL-HPA044730 w/enhanced validation) |
| Citations for Anti CDSN pAb (ATL-HPA044730 w/enhanced validation) – 1 Found |
| Narda, Mridvika; Trullas, Carles; Brown, Anthony; Piquero-Casals, Jaime; Granger, Corinne; Fabbrocini, Gabriella. Glycolic acid adjusted to pH 4 stimulates collagen production and epidermal renewal without affecting levels of proinflammatory TNF-alpha in human skin explants. Journal Of Cosmetic Dermatology. 2021;20(2):513-521. PubMed |