Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies






| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQN |
| Gene Sequence | QELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQN |
| Gene ID - Mouse | ENSMUSG00000054385 |
| Gene ID - Rat | ENSRNOG00000020578 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CEACAM5 pAb (ATL-HPA019758 w/enhanced validation) | |
| Datasheet | Anti CEACAM5 pAb (ATL-HPA019758 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CEACAM5 pAb (ATL-HPA019758 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CEACAM5 pAb (ATL-HPA019758 w/enhanced validation) | |
| Datasheet | Anti CEACAM5 pAb (ATL-HPA019758 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CEACAM5 pAb (ATL-HPA019758 w/enhanced validation) |
| Citations for Anti CEACAM5 pAb (ATL-HPA019758 w/enhanced validation) – 1 Found |
| Gonzalez-Exposito, Reyes; Semiannikova, Maria; Griffiths, Beatrice; Khan, Khurum; Barber, Louise J; Woolston, Andrew; Spain, Georgia; von Loga, Katharina; Challoner, Ben; Patel, Radhika; Ranes, Michael; Swain, Amanda; Thomas, Janet; Bryant, Annette; Saffery, Claire; Fotiadis, Nicos; Guettler, Sebastian; Mansfield, David; Melcher, Alan; Powles, Thomas; Rao, Sheela; Watkins, David; Chau, Ian; Matthews, Nik; Wallberg, Fredrik; Starling, Naureen; Cunningham, David; Gerlinger, Marco. CEA expression heterogeneity and plasticity confer resistance to the CEA-targeting bispecific immunotherapy antibody cibisatamab (CEA-TCB) in patient-derived colorectal cancer organoids. Journal For Immunotherapy Of Cancer. 2019;7(1):101. PubMed |






| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQN |
| Gene Sequence | QELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQN |
| Gene ID - Mouse | ENSMUSG00000054385 |
| Gene ID - Rat | ENSRNOG00000020578 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CEACAM5 pAb (ATL-HPA019758 w/enhanced validation) | |
| Datasheet | Anti CEACAM5 pAb (ATL-HPA019758 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CEACAM5 pAb (ATL-HPA019758 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CEACAM5 pAb (ATL-HPA019758 w/enhanced validation) | |
| Datasheet | Anti CEACAM5 pAb (ATL-HPA019758 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CEACAM5 pAb (ATL-HPA019758 w/enhanced validation) |
| Citations for Anti CEACAM5 pAb (ATL-HPA019758 w/enhanced validation) – 1 Found |
| Gonzalez-Exposito, Reyes; Semiannikova, Maria; Griffiths, Beatrice; Khan, Khurum; Barber, Louise J; Woolston, Andrew; Spain, Georgia; von Loga, Katharina; Challoner, Ben; Patel, Radhika; Ranes, Michael; Swain, Amanda; Thomas, Janet; Bryant, Annette; Saffery, Claire; Fotiadis, Nicos; Guettler, Sebastian; Mansfield, David; Melcher, Alan; Powles, Thomas; Rao, Sheela; Watkins, David; Chau, Ian; Matthews, Nik; Wallberg, Fredrik; Starling, Naureen; Cunningham, David; Gerlinger, Marco. CEA expression heterogeneity and plasticity confer resistance to the CEA-targeting bispecific immunotherapy antibody cibisatamab (CEA-TCB) in patient-derived colorectal cancer organoids. Journal For Immunotherapy Of Cancer. 2019;7(1):101. PubMed |