Loading...
Loading...
Loading...
Loading...
Atlas Antibodies


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VLLDSLDSVAEVNLDEQDKITPKPRCLPEMTENEMTGTGVSYGQSSSDVEALHQAYCHIAHSLGDEDKQKIESNTVEDIKSSVKGHPQEN |
| Gene Sequence | VLLDSLDSVAEVNLDEQDKITPKPRCLPEMTENEMTGTGVSYGQSSSDVEALHQAYCHIAHSLGDEDKQKIESNTVEDIKSSVKGHPQEN |
| Gene ID - Mouse | ENSMUSG00000056919 |
| Gene ID - Rat | ENSRNOG00000010608 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CEP162 pAb (ATL-HPA030170) | |
| Datasheet | Anti CEP162 pAb (ATL-HPA030170) Datasheet (External Link) |
| Vendor Page | Anti CEP162 pAb (ATL-HPA030170) at Atlas Antibodies |
| Documents & Links for Anti CEP162 pAb (ATL-HPA030170) | |
| Datasheet | Anti CEP162 pAb (ATL-HPA030170) Datasheet (External Link) |
| Vendor Page | Anti CEP162 pAb (ATL-HPA030170) |
| Citations for Anti CEP162 pAb (ATL-HPA030170) – 4 Found |
| Srivastava, Shalabh; Ramsbottom, Simon A; Molinari, Elisa; Alkanderi, Sumaya; Filby, Andrew; White, Kathryn; Henry, Charline; Saunier, Sophie; Miles, Colin G; Sayer, John A. A human patient-derived cellular model of Joubert syndrome reveals ciliary defects which can be rescued with targeted therapies. Human Molecular Genetics. 2017;26(23):4657-4667. PubMed |
| Weng, Rueyhung Roc; Yang, T Tony; Huang, Chia-En; Chang, Chih-Wei; Wang, Won-Jing; Liao, Jung-Chi. Super-Resolution Imaging Reveals TCTN2 Depletion-Induced IFT88 Lumen Leakage and Ciliary Weakening. Biophysical Journal. 2018;115(2):263-275. PubMed |
| Wang, Won-Jing; Tay, Hwee Goon; Soni, Rajesh; Perumal, Geoffrey S; Goll, Mary G; Macaluso, Frank P; Asara, John M; Amack, Jeffrey D; Tsou, Meng-Fu Bryan. CEP162 is an axoneme-recognition protein promoting ciliary transition zone assembly at the cilia base. Nature Cell Biology. 2013;15(6):591-601. PubMed |
| Hall, Emma A; Kumar, Dhivya; Prosser, Suzanna L; Yeyati, Patricia L; Herranz-Pérez, Vicente; García-Verdugo, Jose Manuel; Rose, Lorraine; McKie, Lisa; Dodd, Daniel O; Tennant, Peter A; Megaw, Roly; Murphy, Laura C; Ferreira, Marisa F; Grimes, Graeme; Williams, Lucy; Quidwai, Tooba; Pelletier, Laurence; Reiter, Jeremy F; Mill, Pleasantine. Centriolar satellites expedite mother centriole remodeling to promote ciliogenesis. Elife. 2023;12( 36790165) PubMed |
No reviews have been added for this product.
Try browsing our complete catalog of products.
Atlas Antibodies


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VLLDSLDSVAEVNLDEQDKITPKPRCLPEMTENEMTGTGVSYGQSSSDVEALHQAYCHIAHSLGDEDKQKIESNTVEDIKSSVKGHPQEN |
| Gene Sequence | VLLDSLDSVAEVNLDEQDKITPKPRCLPEMTENEMTGTGVSYGQSSSDVEALHQAYCHIAHSLGDEDKQKIESNTVEDIKSSVKGHPQEN |
| Gene ID - Mouse | ENSMUSG00000056919 |
| Gene ID - Rat | ENSRNOG00000010608 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CEP162 pAb (ATL-HPA030170) | |
| Datasheet | Anti CEP162 pAb (ATL-HPA030170) Datasheet (External Link) |
| Vendor Page | Anti CEP162 pAb (ATL-HPA030170) at Atlas Antibodies |
| Documents & Links for Anti CEP162 pAb (ATL-HPA030170) | |
| Datasheet | Anti CEP162 pAb (ATL-HPA030170) Datasheet (External Link) |
| Vendor Page | Anti CEP162 pAb (ATL-HPA030170) |
| Citations for Anti CEP162 pAb (ATL-HPA030170) – 4 Found |
| Srivastava, Shalabh; Ramsbottom, Simon A; Molinari, Elisa; Alkanderi, Sumaya; Filby, Andrew; White, Kathryn; Henry, Charline; Saunier, Sophie; Miles, Colin G; Sayer, John A. A human patient-derived cellular model of Joubert syndrome reveals ciliary defects which can be rescued with targeted therapies. Human Molecular Genetics. 2017;26(23):4657-4667. PubMed |
| Weng, Rueyhung Roc; Yang, T Tony; Huang, Chia-En; Chang, Chih-Wei; Wang, Won-Jing; Liao, Jung-Chi. Super-Resolution Imaging Reveals TCTN2 Depletion-Induced IFT88 Lumen Leakage and Ciliary Weakening. Biophysical Journal. 2018;115(2):263-275. PubMed |
| Wang, Won-Jing; Tay, Hwee Goon; Soni, Rajesh; Perumal, Geoffrey S; Goll, Mary G; Macaluso, Frank P; Asara, John M; Amack, Jeffrey D; Tsou, Meng-Fu Bryan. CEP162 is an axoneme-recognition protein promoting ciliary transition zone assembly at the cilia base. Nature Cell Biology. 2013;15(6):591-601. PubMed |
| Hall, Emma A; Kumar, Dhivya; Prosser, Suzanna L; Yeyati, Patricia L; Herranz-Pérez, Vicente; García-Verdugo, Jose Manuel; Rose, Lorraine; McKie, Lisa; Dodd, Daniel O; Tennant, Peter A; Megaw, Roly; Murphy, Laura C; Ferreira, Marisa F; Grimes, Graeme; Williams, Lucy; Quidwai, Tooba; Pelletier, Laurence; Reiter, Jeremy F; Mill, Pleasantine. Centriolar satellites expedite mother centriole remodeling to promote ciliogenesis. Elife. 2023;12( 36790165) PubMed |