Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies




| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LRVSISREQSFFGSPLAHDPFSCLQLVGQENVCGDDYDEAVKLKESVVENHAVLSYAVEEEHAYLGPTVKPDDKAKTLSYEPLSSATVSTGSLLSYENTDLS |
| Gene Sequence | LRVSISREQSFFGSPLAHDPFSCLQLVGQENVCGDDYDEAVKLKESVVENHAVLSYAVEEEHAYLGPTVKPDDKAKTLSYEPLSSATVSTGSLLSYENTDLS |
| Gene ID - Mouse | ENSMUSG00000046111 |
| Gene ID - Rat | ENSRNOG00000010999 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CEP295 pAb (ATL-HPA038596) | |
| Datasheet | Anti CEP295 pAb (ATL-HPA038596) Datasheet (External Link) |
| Vendor Page | Anti CEP295 pAb (ATL-HPA038596) at Atlas Antibodies |
| Documents & Links for Anti CEP295 pAb (ATL-HPA038596) | |
| Datasheet | Anti CEP295 pAb (ATL-HPA038596) Datasheet (External Link) |
| Vendor Page | Anti CEP295 pAb (ATL-HPA038596) |
| Citations for Anti CEP295 pAb (ATL-HPA038596) – 2 Found |
| Ito, Kei K; Watanabe, Koki; Ishida, Haruki; Matsuhashi, Kyohei; Chinen, Takumi; Hata, Shoji; Kitagawa, Daiju. Cep57 and Cep57L1 maintain centriole engagement in interphase to ensure centriole duplication cycle. The Journal Of Cell Biology. 2021;220(3) PubMed |
| Tsuchiya, Yuki; Yoshiba, Satoko; Gupta, Akshari; Watanabe, Koki; Kitagawa, Daiju. Cep295 is a conserved scaffold protein required for generation of a bona fide mother centriole. Nature Communications. 2016;7( 27562453):12567. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies




| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LRVSISREQSFFGSPLAHDPFSCLQLVGQENVCGDDYDEAVKLKESVVENHAVLSYAVEEEHAYLGPTVKPDDKAKTLSYEPLSSATVSTGSLLSYENTDLS |
| Gene Sequence | LRVSISREQSFFGSPLAHDPFSCLQLVGQENVCGDDYDEAVKLKESVVENHAVLSYAVEEEHAYLGPTVKPDDKAKTLSYEPLSSATVSTGSLLSYENTDLS |
| Gene ID - Mouse | ENSMUSG00000046111 |
| Gene ID - Rat | ENSRNOG00000010999 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CEP295 pAb (ATL-HPA038596) | |
| Datasheet | Anti CEP295 pAb (ATL-HPA038596) Datasheet (External Link) |
| Vendor Page | Anti CEP295 pAb (ATL-HPA038596) at Atlas Antibodies |
| Documents & Links for Anti CEP295 pAb (ATL-HPA038596) | |
| Datasheet | Anti CEP295 pAb (ATL-HPA038596) Datasheet (External Link) |
| Vendor Page | Anti CEP295 pAb (ATL-HPA038596) |
| Citations for Anti CEP295 pAb (ATL-HPA038596) – 2 Found |
| Ito, Kei K; Watanabe, Koki; Ishida, Haruki; Matsuhashi, Kyohei; Chinen, Takumi; Hata, Shoji; Kitagawa, Daiju. Cep57 and Cep57L1 maintain centriole engagement in interphase to ensure centriole duplication cycle. The Journal Of Cell Biology. 2021;220(3) PubMed |
| Tsuchiya, Yuki; Yoshiba, Satoko; Gupta, Akshari; Watanabe, Koki; Kitagawa, Daiju. Cep295 is a conserved scaffold protein required for generation of a bona fide mother centriole. Nature Communications. 2016;7( 27562453):12567. PubMed |