Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ALETNTTLVVLDIRKNPLIDHSMMKAVIKKVLQNGRSAKSEYQWITSPSVKEPSKTAKQKRRTIILGSGHKGKATIRIGLATKKPVSSGRK |
| Gene Sequence | ALETNTTLVVLDIRKNPLIDHSMMKAVIKKVLQNGRSAKSEYQWITSPSVKEPSKTAKQKRRTIILGSGHKGKATIRIGLATKKPVSSGRK |
| Gene ID - Mouse | ENSMUSG00000041491 |
| Gene ID - Rat | ENSRNOG00000014041 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CEP78 pAb (ATL-HPA048846) | |
| Datasheet | Anti CEP78 pAb (ATL-HPA048846) Datasheet (External Link) |
| Vendor Page | Anti CEP78 pAb (ATL-HPA048846) at Atlas Antibodies |
| Documents & Links for Anti CEP78 pAb (ATL-HPA048846) | |
| Datasheet | Anti CEP78 pAb (ATL-HPA048846) Datasheet (External Link) |
| Vendor Page | Anti CEP78 pAb (ATL-HPA048846) |
| Citations for Anti CEP78 pAb (ATL-HPA048846) – 1 Found |
| Namburi, Prasanthi; Ratnapriya, Rinki; Khateb, Samer; Lazar, Csilla H; Kinarty, Yael; Obolensky, Alexey; Erdinest, Inbar; Marks-Ohana, Devorah; Pras, Eran; Ben-Yosef, Tamar; Newman, Hadas; Gross, Menachem; Swaroop, Anand; Banin, Eyal; Sharon, Dror. Bi-allelic Truncating Mutations in CEP78, Encoding Centrosomal Protein 78, Cause Cone-Rod Degeneration with Sensorineural Hearing Loss. American Journal Of Human Genetics. 2016;99(3):777-784. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ALETNTTLVVLDIRKNPLIDHSMMKAVIKKVLQNGRSAKSEYQWITSPSVKEPSKTAKQKRRTIILGSGHKGKATIRIGLATKKPVSSGRK |
| Gene Sequence | ALETNTTLVVLDIRKNPLIDHSMMKAVIKKVLQNGRSAKSEYQWITSPSVKEPSKTAKQKRRTIILGSGHKGKATIRIGLATKKPVSSGRK |
| Gene ID - Mouse | ENSMUSG00000041491 |
| Gene ID - Rat | ENSRNOG00000014041 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CEP78 pAb (ATL-HPA048846) | |
| Datasheet | Anti CEP78 pAb (ATL-HPA048846) Datasheet (External Link) |
| Vendor Page | Anti CEP78 pAb (ATL-HPA048846) at Atlas Antibodies |
| Documents & Links for Anti CEP78 pAb (ATL-HPA048846) | |
| Datasheet | Anti CEP78 pAb (ATL-HPA048846) Datasheet (External Link) |
| Vendor Page | Anti CEP78 pAb (ATL-HPA048846) |
| Citations for Anti CEP78 pAb (ATL-HPA048846) – 1 Found |
| Namburi, Prasanthi; Ratnapriya, Rinki; Khateb, Samer; Lazar, Csilla H; Kinarty, Yael; Obolensky, Alexey; Erdinest, Inbar; Marks-Ohana, Devorah; Pras, Eran; Ben-Yosef, Tamar; Newman, Hadas; Gross, Menachem; Swaroop, Anand; Banin, Eyal; Sharon, Dror. Bi-allelic Truncating Mutations in CEP78, Encoding Centrosomal Protein 78, Cause Cone-Rod Degeneration with Sensorineural Hearing Loss. American Journal Of Human Genetics. 2016;99(3):777-784. PubMed |