Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PAPTVIRDPPSITPAVKSPLPGPSEEKTLQPSSQNTKAHPSRRVTLNTLQAWSKTTPRRINLTPLKTDTPPSSVPTSVISTPSTEEIQSETPGDAQGSPPELKRPRLDENKG |
| Gene Sequence | PAPTVIRDPPSITPAVKSPLPGPSEEKTLQPSSQNTKAHPSRRVTLNTLQAWSKTTPRRINLTPLKTDTPPSSVPTSVISTPSTEEIQSETPGDAQGSPPELKRPRLDENKG |
| Gene ID - Mouse | ENSMUSG00000022945 |
| Gene ID - Rat | ENSRNOG00000001692 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CHAF1B pAb (ATL-HPA021679) | |
| Datasheet | Anti CHAF1B pAb (ATL-HPA021679) Datasheet (External Link) |
| Vendor Page | Anti CHAF1B pAb (ATL-HPA021679) at Atlas Antibodies |
| Documents & Links for Anti CHAF1B pAb (ATL-HPA021679) | |
| Datasheet | Anti CHAF1B pAb (ATL-HPA021679) Datasheet (External Link) |
| Vendor Page | Anti CHAF1B pAb (ATL-HPA021679) |
| Citations for Anti CHAF1B pAb (ATL-HPA021679) – 3 Found |
| Gomes, Ana P; Ilter, Didem; Low, Vivien; Rosenzweig, Adam; Shen, Zih-Jie; Schild, Tanya; Rivas, Martin A; Er, Ekrem E; McNally, Dylan R; Mutvei, Anders P; Han, Julie; Ou, Yi-Hung; Cavaliere, Paola; Mullarky, Edouard; Nagiec, Michal; Shin, Sejeong; Yoon, Sang-Oh; Dephoure, Noah; Massagué, Joan; Melnick, Ari M; Cantley, Lewis C; Tyler, Jessica K; Blenis, John. Dynamic Incorporation of Histone H3 Variants into Chromatin Is Essential for Acquisition of Aggressive Traits and Metastatic Colonization. Cancer Cell. 2019;36(4):402-417.e13. PubMed |
| Morra, Francesco; Merolla, Francesco; Picardi, Ida; Russo, Daniela; Ilardi, Gennaro; Varricchio, Silvia; Liotti, Federica; Pacelli, Roberto; Palazzo, Luca; Mascolo, Massimo; Celetti, Angela; Staibano, Stefania. CAF-1 Subunits Levels Suggest Combined Treatments with PARP-Inhibitors and Ionizing Radiation in Advanced HNSCC. Cancers. 2019;11(10) PubMed |
| Ilter, Didem; Drapela, Stanislav; Schild, Tanya; Ward, Nathan P; Adhikari, Emma; Low, Vivien; Asara, John; Oskarsson, Thordur; Lau, Eric K; DeNicola, Gina M; McReynolds, Melanie R; Gomes, Ana P. NADK-mediated de novo NADP(H) synthesis is a metabolic adaptation essential for breast cancer metastasis. Redox Biology. 2023;61( 36841051):102627. PubMed |
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PAPTVIRDPPSITPAVKSPLPGPSEEKTLQPSSQNTKAHPSRRVTLNTLQAWSKTTPRRINLTPLKTDTPPSSVPTSVISTPSTEEIQSETPGDAQGSPPELKRPRLDENKG |
| Gene Sequence | PAPTVIRDPPSITPAVKSPLPGPSEEKTLQPSSQNTKAHPSRRVTLNTLQAWSKTTPRRINLTPLKTDTPPSSVPTSVISTPSTEEIQSETPGDAQGSPPELKRPRLDENKG |
| Gene ID - Mouse | ENSMUSG00000022945 |
| Gene ID - Rat | ENSRNOG00000001692 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CHAF1B pAb (ATL-HPA021679) | |
| Datasheet | Anti CHAF1B pAb (ATL-HPA021679) Datasheet (External Link) |
| Vendor Page | Anti CHAF1B pAb (ATL-HPA021679) at Atlas Antibodies |
| Documents & Links for Anti CHAF1B pAb (ATL-HPA021679) | |
| Datasheet | Anti CHAF1B pAb (ATL-HPA021679) Datasheet (External Link) |
| Vendor Page | Anti CHAF1B pAb (ATL-HPA021679) |
| Citations for Anti CHAF1B pAb (ATL-HPA021679) – 3 Found |
| Gomes, Ana P; Ilter, Didem; Low, Vivien; Rosenzweig, Adam; Shen, Zih-Jie; Schild, Tanya; Rivas, Martin A; Er, Ekrem E; McNally, Dylan R; Mutvei, Anders P; Han, Julie; Ou, Yi-Hung; Cavaliere, Paola; Mullarky, Edouard; Nagiec, Michal; Shin, Sejeong; Yoon, Sang-Oh; Dephoure, Noah; Massagué, Joan; Melnick, Ari M; Cantley, Lewis C; Tyler, Jessica K; Blenis, John. Dynamic Incorporation of Histone H3 Variants into Chromatin Is Essential for Acquisition of Aggressive Traits and Metastatic Colonization. Cancer Cell. 2019;36(4):402-417.e13. PubMed |
| Morra, Francesco; Merolla, Francesco; Picardi, Ida; Russo, Daniela; Ilardi, Gennaro; Varricchio, Silvia; Liotti, Federica; Pacelli, Roberto; Palazzo, Luca; Mascolo, Massimo; Celetti, Angela; Staibano, Stefania. CAF-1 Subunits Levels Suggest Combined Treatments with PARP-Inhibitors and Ionizing Radiation in Advanced HNSCC. Cancers. 2019;11(10) PubMed |
| Ilter, Didem; Drapela, Stanislav; Schild, Tanya; Ward, Nathan P; Adhikari, Emma; Low, Vivien; Asara, John; Oskarsson, Thordur; Lau, Eric K; DeNicola, Gina M; McReynolds, Melanie R; Gomes, Ana P. NADK-mediated de novo NADP(H) synthesis is a metabolic adaptation essential for breast cancer metastasis. Redox Biology. 2023;61( 36841051):102627. PubMed |