Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies






| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YQQHQGTQPAQQQQPCLYEIKQFLECAQNQGDIKLCEGFNEVLKQCRLANR |
| Gene Sequence | YQQHQGTQPAQQQQPCLYEIKQFLECAQNQGDIKLCEGFNEVLKQCRLANR |
| Gene ID - Mouse | ENSMUSG00000034173 |
| Gene ID - Rat | ENSRNOG00000000918 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CHCHD2 pAb (ATL-HPA027407 w/enhanced validation) | |
| Datasheet | Anti CHCHD2 pAb (ATL-HPA027407 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CHCHD2 pAb (ATL-HPA027407 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CHCHD2 pAb (ATL-HPA027407 w/enhanced validation) | |
| Datasheet | Anti CHCHD2 pAb (ATL-HPA027407 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CHCHD2 pAb (ATL-HPA027407 w/enhanced validation) |
| Citations for Anti CHCHD2 pAb (ATL-HPA027407 w/enhanced validation) – 6 Found |
| Zhu, Lili; Gomez-Duran, Aurora; Saretzki, Gabriele; Jin, Shibo; Tilgner, Katarzyna; Melguizo-Sanchis, Dario; Anyfantis, Georgios; Al-Aama, Jumana; Vallier, Ludovic; Chinnery, Patrick; Lako, Majlinda; Armstrong, Lyle. The mitochondrial protein CHCHD2 primes the differentiation potential of human induced pluripotent stem cells to neuroectodermal lineages. The Journal Of Cell Biology. 2016;215(2):187-202. PubMed |
| Straub, Isabella R; Janer, Alexandre; Weraarpachai, Woranontee; Zinman, Lorne; Robertson, Janice; Rogaeva, Ekaterina; Shoubridge, Eric A. Loss of CHCHD10-CHCHD2 complexes required for respiration underlies the pathogenicity of a CHCHD10 mutation in ALS. Human Molecular Genetics. 2018;27(1):178-189. PubMed |
| Zhou, Wei; Ma, Dongrui; Sun, Alfred Xuyang; Tran, Hoang-Dai; Ma, Dong-Liang; Singh, Brijesh K; Zhou, Jin; Zhang, Jinyan; Wang, Danlei; Zhao, Yi; Yen, Paul M; Goh, Eyleen; Tan, Eng-King. PD-linked CHCHD2 mutations impair CHCHD10 and MICOS complex leading to mitochondria dysfunction. Human Molecular Genetics. 2019;28(7):1100-1116. PubMed |
| Huang, Xiaoping; Wu, Beverly P; Nguyen, Diana; Liu, Yi-Ting; Marani, Melika; Hench, Jürgen; Bénit, Paule; Kozjak-Pavlovic, Vera; Rustin, Pierre; Frank, Stephan; Narendra, Derek P. CHCHD2 accumulates in distressed mitochondria and facilitates oligomerization of CHCHD10. Human Molecular Genetics. 2018;27(22):3881-3900. PubMed |
| Liu, Yi-Ting; Huang, Xiaoping; Nguyen, Diana; Shammas, Mario K; Wu, Beverly P; Dombi, Eszter; Springer, Danielle A; Poulton, Joanna; Sekine, Shiori; Narendra, Derek P. Loss of CHCHD2 and CHCHD10 activates OMA1 peptidase to disrupt mitochondrial cristae phenocopying patient mutations. Human Molecular Genetics. 2020;29(9):1547-1567. PubMed |
| Li, Yue; Xiu, Wenjing; Xu, Jingwen; Chen, Xiangmei; Wang, Guangyan; Duan, Jinjie; Sun, Lei; Liu, Ben; Xie, Wen; Pu, Guangyin; Wang, Qi; Wang, Chunjiong. Increased CHCHD2 expression promotes liver fibrosis in nonalcoholic steatohepatitis via Notch/osteopontin signaling. Jci Insight. 2022;7(23) PubMed |






| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YQQHQGTQPAQQQQPCLYEIKQFLECAQNQGDIKLCEGFNEVLKQCRLANR |
| Gene Sequence | YQQHQGTQPAQQQQPCLYEIKQFLECAQNQGDIKLCEGFNEVLKQCRLANR |
| Gene ID - Mouse | ENSMUSG00000034173 |
| Gene ID - Rat | ENSRNOG00000000918 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CHCHD2 pAb (ATL-HPA027407 w/enhanced validation) | |
| Datasheet | Anti CHCHD2 pAb (ATL-HPA027407 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CHCHD2 pAb (ATL-HPA027407 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CHCHD2 pAb (ATL-HPA027407 w/enhanced validation) | |
| Datasheet | Anti CHCHD2 pAb (ATL-HPA027407 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CHCHD2 pAb (ATL-HPA027407 w/enhanced validation) |
| Citations for Anti CHCHD2 pAb (ATL-HPA027407 w/enhanced validation) – 6 Found |
| Zhu, Lili; Gomez-Duran, Aurora; Saretzki, Gabriele; Jin, Shibo; Tilgner, Katarzyna; Melguizo-Sanchis, Dario; Anyfantis, Georgios; Al-Aama, Jumana; Vallier, Ludovic; Chinnery, Patrick; Lako, Majlinda; Armstrong, Lyle. The mitochondrial protein CHCHD2 primes the differentiation potential of human induced pluripotent stem cells to neuroectodermal lineages. The Journal Of Cell Biology. 2016;215(2):187-202. PubMed |
| Straub, Isabella R; Janer, Alexandre; Weraarpachai, Woranontee; Zinman, Lorne; Robertson, Janice; Rogaeva, Ekaterina; Shoubridge, Eric A. Loss of CHCHD10-CHCHD2 complexes required for respiration underlies the pathogenicity of a CHCHD10 mutation in ALS. Human Molecular Genetics. 2018;27(1):178-189. PubMed |
| Zhou, Wei; Ma, Dongrui; Sun, Alfred Xuyang; Tran, Hoang-Dai; Ma, Dong-Liang; Singh, Brijesh K; Zhou, Jin; Zhang, Jinyan; Wang, Danlei; Zhao, Yi; Yen, Paul M; Goh, Eyleen; Tan, Eng-King. PD-linked CHCHD2 mutations impair CHCHD10 and MICOS complex leading to mitochondria dysfunction. Human Molecular Genetics. 2019;28(7):1100-1116. PubMed |
| Huang, Xiaoping; Wu, Beverly P; Nguyen, Diana; Liu, Yi-Ting; Marani, Melika; Hench, Jürgen; Bénit, Paule; Kozjak-Pavlovic, Vera; Rustin, Pierre; Frank, Stephan; Narendra, Derek P. CHCHD2 accumulates in distressed mitochondria and facilitates oligomerization of CHCHD10. Human Molecular Genetics. 2018;27(22):3881-3900. PubMed |
| Liu, Yi-Ting; Huang, Xiaoping; Nguyen, Diana; Shammas, Mario K; Wu, Beverly P; Dombi, Eszter; Springer, Danielle A; Poulton, Joanna; Sekine, Shiori; Narendra, Derek P. Loss of CHCHD2 and CHCHD10 activates OMA1 peptidase to disrupt mitochondrial cristae phenocopying patient mutations. Human Molecular Genetics. 2020;29(9):1547-1567. PubMed |
| Li, Yue; Xiu, Wenjing; Xu, Jingwen; Chen, Xiangmei; Wang, Guangyan; Duan, Jinjie; Sun, Lei; Liu, Ben; Xie, Wen; Pu, Guangyin; Wang, Qi; Wang, Chunjiong. Increased CHCHD2 expression promotes liver fibrosis in nonalcoholic steatohepatitis via Notch/osteopontin signaling. Jci Insight. 2022;7(23) PubMed |