Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ASSNSSLSGSSVSSDAEEYQPPIWKSYLYQLQQEAPRPKRIICPREVENRPKY |
| Gene Sequence | ASSNSSLSGSSVSSDAEEYQPPIWKSYLYQLQQEAPRPKRIICPREVENRPKY |
| Gene ID - Mouse | ENSMUSG00000004633 |
| Gene ID - Rat | ENSRNOG00000009411 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CHN2 pAb (ATL-HPA018989) | |
| Datasheet | Anti CHN2 pAb (ATL-HPA018989) Datasheet (External Link) |
| Vendor Page | Anti CHN2 pAb (ATL-HPA018989) at Atlas Antibodies |
| Documents & Links for Anti CHN2 pAb (ATL-HPA018989) | |
| Datasheet | Anti CHN2 pAb (ATL-HPA018989) Datasheet (External Link) |
| Vendor Page | Anti CHN2 pAb (ATL-HPA018989) |
| Citations for Anti CHN2 pAb (ATL-HPA018989) – 3 Found |
| Elaimy, Ameer L; Guru, Santosh; Chang, Cheng; Ou, Jianhong; Amante, John J; Zhu, Lihua Julie; Goel, Hira Lal; Mercurio, Arthur M. VEGF-neuropilin-2 signaling promotes stem-like traits in breast cancer cells by TAZ-mediated repression of the Rac GAP β2-chimaerin. Science Signaling. 2018;11(528) PubMed |
| Alvi, Muhammad A; McArt, Darragh G; Kelly, Paul; Fuchs, Marc-Aurel; Alderdice, Matthew; McCabe, Clare M; Bingham, Victoria; McGready, Claire; Tripathi, Shailesh; Emmert-Streib, Frank; Loughrey, Maurice B; McQuaid, Stephen; Maxwell, Perry; Hamilton, Peter W; Turkington, Richard; James, Jacqueline A; Wilson, Richard H; Salto-Tellez, Manuel. Comprehensive molecular pathology analysis of small bowel adenocarcinoma reveals novel targets with potential for clinical utility. Oncotarget. 2015;6(25):20863-74. PubMed |
| Casado-Medrano, Victoria; Barrio-Real, Laura; García-Rostán, Ginesa; Baumann, Matti; Rocks, Oliver; Caloca, María J. A new role of the Rac-GAP β2-chimaerin in cell adhesion reveals opposite functions in breast cancer initiation and tumor progression. Oncotarget. 2016;7(19):28301-19. PubMed |


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ASSNSSLSGSSVSSDAEEYQPPIWKSYLYQLQQEAPRPKRIICPREVENRPKY |
| Gene Sequence | ASSNSSLSGSSVSSDAEEYQPPIWKSYLYQLQQEAPRPKRIICPREVENRPKY |
| Gene ID - Mouse | ENSMUSG00000004633 |
| Gene ID - Rat | ENSRNOG00000009411 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CHN2 pAb (ATL-HPA018989) | |
| Datasheet | Anti CHN2 pAb (ATL-HPA018989) Datasheet (External Link) |
| Vendor Page | Anti CHN2 pAb (ATL-HPA018989) at Atlas Antibodies |
| Documents & Links for Anti CHN2 pAb (ATL-HPA018989) | |
| Datasheet | Anti CHN2 pAb (ATL-HPA018989) Datasheet (External Link) |
| Vendor Page | Anti CHN2 pAb (ATL-HPA018989) |
| Citations for Anti CHN2 pAb (ATL-HPA018989) – 3 Found |
| Elaimy, Ameer L; Guru, Santosh; Chang, Cheng; Ou, Jianhong; Amante, John J; Zhu, Lihua Julie; Goel, Hira Lal; Mercurio, Arthur M. VEGF-neuropilin-2 signaling promotes stem-like traits in breast cancer cells by TAZ-mediated repression of the Rac GAP β2-chimaerin. Science Signaling. 2018;11(528) PubMed |
| Alvi, Muhammad A; McArt, Darragh G; Kelly, Paul; Fuchs, Marc-Aurel; Alderdice, Matthew; McCabe, Clare M; Bingham, Victoria; McGready, Claire; Tripathi, Shailesh; Emmert-Streib, Frank; Loughrey, Maurice B; McQuaid, Stephen; Maxwell, Perry; Hamilton, Peter W; Turkington, Richard; James, Jacqueline A; Wilson, Richard H; Salto-Tellez, Manuel. Comprehensive molecular pathology analysis of small bowel adenocarcinoma reveals novel targets with potential for clinical utility. Oncotarget. 2015;6(25):20863-74. PubMed |
| Casado-Medrano, Victoria; Barrio-Real, Laura; García-Rostán, Ginesa; Baumann, Matti; Rocks, Oliver; Caloca, María J. A new role of the Rac-GAP β2-chimaerin in cell adhesion reveals opposite functions in breast cancer initiation and tumor progression. Oncotarget. 2016;7(19):28301-19. PubMed |