Related products

No related products found

Try browsing our complete catalog of products.

Reviews 0

No reviews have been added for this product.

Reviews

Protein Description: cholinergic receptor, muscarinic 5
Gene Name: CHRM5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074939: 86%, ENSRNOG00000006397: 86%
Entrez Gene ID: 1133
Uniprot ID: P08912
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application	IHC
Reactivity	Human
Clonality	Polyclonal
Host	Rabbit
Immunogen	AHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNPNPSHQMTKRK
Gene Sequence	AHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNPNPSHQMTKRK
Gene ID - Mouse	ENSMUSG00000074939
Gene ID - Rat	ENSRNOG00000006397
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CHRM5 pAb (ATL-HPA013172)
Datasheet	Anti CHRM5 pAb (ATL-HPA013172) Datasheet (External Link)
Vendor Page	Anti CHRM5 pAb (ATL-HPA013172) at Atlas Antibodies

Documents & Links for Anti CHRM5 pAb (ATL-HPA013172)
Datasheet	Anti CHRM5 pAb (ATL-HPA013172) Datasheet (External Link)
Vendor Page	Anti CHRM5 pAb (ATL-HPA013172)

Citations for Anti CHRM5 pAb (ATL-HPA013172) – 1 Found

Molina, Judith; Rodriguez-Diaz, Rayner; Fachado, Alberto; Jacques-Silva, M Caroline; Berggren, Per-Olof; Caicedo, Alejandro. Control of insulin secretion by cholinergic signaling in the human pancreatic islet. Diabetes. 2014;63(8):2714-26. PubMed

No related products found

Reviews 0

Reviews

Anti CHRM5 pAb (ATL-HPA013172)

Additional information

Anti CHRM5 pAb (ATL-HPA013172)

Additional information

Specifications

No related products found

Reviews 0

Anti CHRM5 pAb (ATL-HPA013172)

Additional information

Specifications

Anti CHRM5 pAb (ATL-HPA013172)

Additional information

Specifications

Specifications