Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies


![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/51760/37176/atl-hpa041350_anti-ciapin1-pab-atl-hpa041350-wenhanced-validation_48303__42792.1783636842.jpg?compression=lossy)


![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/51760/37176/atl-hpa041350_anti-ciapin1-pab-atl-hpa041350-wenhanced-validation_48303__42792.1783636842.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCL |
| Gene Sequence | FGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCL |
| Gene ID - Mouse | ENSMUSG00000031781 |
| Gene ID - Rat | ENSRNOG00000016234 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CIAPIN1 pAb (ATL-HPA041350 w/enhanced validation) | |
| Datasheet | Anti CIAPIN1 pAb (ATL-HPA041350 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CIAPIN1 pAb (ATL-HPA041350 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CIAPIN1 pAb (ATL-HPA041350 w/enhanced validation) | |
| Datasheet | Anti CIAPIN1 pAb (ATL-HPA041350 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CIAPIN1 pAb (ATL-HPA041350 w/enhanced validation) |
| Citations for Anti CIAPIN1 pAb (ATL-HPA041350 w/enhanced validation) – 1 Found |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |


![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/51760/37176/atl-hpa041350_anti-ciapin1-pab-atl-hpa041350-wenhanced-validation_48303__42792.1783636842.jpg?compression=lossy)


![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/51760/37176/atl-hpa041350_anti-ciapin1-pab-atl-hpa041350-wenhanced-validation_48303__42792.1783636842.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCL |
| Gene Sequence | FGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCL |
| Gene ID - Mouse | ENSMUSG00000031781 |
| Gene ID - Rat | ENSRNOG00000016234 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CIAPIN1 pAb (ATL-HPA041350 w/enhanced validation) | |
| Datasheet | Anti CIAPIN1 pAb (ATL-HPA041350 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CIAPIN1 pAb (ATL-HPA041350 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CIAPIN1 pAb (ATL-HPA041350 w/enhanced validation) | |
| Datasheet | Anti CIAPIN1 pAb (ATL-HPA041350 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CIAPIN1 pAb (ATL-HPA041350 w/enhanced validation) |
| Citations for Anti CIAPIN1 pAb (ATL-HPA041350 w/enhanced validation) – 1 Found |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |