Related products

No related products found

Try browsing our complete catalog of products.

Reviews 0

No reviews have been added for this product.

Reviews

Protein Description: cardiotrophin-like cytokine factor 1
Gene Name: CLCF1
Alternative Gene Name: BSF-3, BSF3, CISS2, CLC, NNT-1, NNT1, NR6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000097629: 97%, ENSRNOG00000018752: 97%
Entrez Gene ID: 23529
Uniprot ID: Q9UBD9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application	WB, ICC, IHC
Reactivity	Human
Clonality	Polyclonal
Host	Rabbit
Immunogen	KTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYE
Gene Sequence	KTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYE
Gene ID - Mouse	ENSMUSG00000097629
Gene ID - Rat	ENSRNOG00000018752
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CLCF1 pAb (ATL-HPA042444)
Datasheet	Anti CLCF1 pAb (ATL-HPA042444) Datasheet (External Link)
Vendor Page	Anti CLCF1 pAb (ATL-HPA042444) at Atlas Antibodies

Documents & Links for Anti CLCF1 pAb (ATL-HPA042444)
Datasheet	Anti CLCF1 pAb (ATL-HPA042444) Datasheet (External Link)
Vendor Page	Anti CLCF1 pAb (ATL-HPA042444)

Citations for Anti CLCF1 pAb (ATL-HPA042444) – 1 Found

Zhang, Zhongqiang; Tan, Xiao; Luo, Jing; Yao, Hongliang; Si, Zhongzhou; Tong, Jing-Shan. The miR-30a-5p/CLCF1 axis regulates sorafenib resistance and aerobic glycolysis in hepatocellular carcinoma. Cell Death & Disease. 2020;11(10):902. PubMed

No related products found

Reviews 0

Reviews

Anti CLCF1 pAb (ATL-HPA042444)

Additional information

Anti CLCF1 pAb (ATL-HPA042444)

Additional information

Specifications

No related products found

Reviews 0

Anti CLCF1 pAb (ATL-HPA042444)

Additional information

Specifications

Anti CLCF1 pAb (ATL-HPA042444)

Additional information

Specifications

Specifications