Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GVDHAYVTSIGRLIGIVTLKELRKAIEGSVTAQGVKVRPPLASFRDSATSSSDTETTEVHALWGPHSRHG |
| Gene Sequence | GVDHAYVTSIGRLIGIVTLKELRKAIEGSVTAQGVKVRPPLASFRDSATSSSDTETTEVHALWGPHSRHG |
| Gene ID - Mouse | ENSMUSG00000022843 |
| Gene ID - Rat | ENSRNOG00000050854 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CLCN2 pAb (ATL-HPA014545) | |
| Datasheet | Anti CLCN2 pAb (ATL-HPA014545) Datasheet (External Link) |
| Vendor Page | Anti CLCN2 pAb (ATL-HPA014545) at Atlas Antibodies |
| Documents & Links for Anti CLCN2 pAb (ATL-HPA014545) | |
| Datasheet | Anti CLCN2 pAb (ATL-HPA014545) Datasheet (External Link) |
| Vendor Page | Anti CLCN2 pAb (ATL-HPA014545) |
| Citations for Anti CLCN2 pAb (ATL-HPA014545) – 1 Found |
| Scholl, Ute I; Stölting, Gabriel; Schewe, Julia; Thiel, Anne; Tan, Hua; Nelson-Williams, Carol; Vichot, Alfred A; Jin, Sheng Chih; Loring, Erin; Untiet, Verena; Yoo, Taekyeong; Choi, Jungmin; Xu, Shengxin; Wu, Aihua; Kirchner, Marieluise; Mertins, Philipp; Rump, Lars C; Onder, Ali Mirza; Gamble, Cory; McKenney, Daniel; Lash, Robert W; Jones, Deborah P; Chune, Gary; Gagliardi, Priscila; Choi, Murim; Gordon, Richard; Stowasser, Michael; Fahlke, Christoph; Lifton, Richard P. CLCN2 chloride channel mutations in familial hyperaldosteronism type II. Nature Genetics. 2018;50(3):349-354. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GVDHAYVTSIGRLIGIVTLKELRKAIEGSVTAQGVKVRPPLASFRDSATSSSDTETTEVHALWGPHSRHG |
| Gene Sequence | GVDHAYVTSIGRLIGIVTLKELRKAIEGSVTAQGVKVRPPLASFRDSATSSSDTETTEVHALWGPHSRHG |
| Gene ID - Mouse | ENSMUSG00000022843 |
| Gene ID - Rat | ENSRNOG00000050854 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CLCN2 pAb (ATL-HPA014545) | |
| Datasheet | Anti CLCN2 pAb (ATL-HPA014545) Datasheet (External Link) |
| Vendor Page | Anti CLCN2 pAb (ATL-HPA014545) at Atlas Antibodies |
| Documents & Links for Anti CLCN2 pAb (ATL-HPA014545) | |
| Datasheet | Anti CLCN2 pAb (ATL-HPA014545) Datasheet (External Link) |
| Vendor Page | Anti CLCN2 pAb (ATL-HPA014545) |
| Citations for Anti CLCN2 pAb (ATL-HPA014545) – 1 Found |
| Scholl, Ute I; Stölting, Gabriel; Schewe, Julia; Thiel, Anne; Tan, Hua; Nelson-Williams, Carol; Vichot, Alfred A; Jin, Sheng Chih; Loring, Erin; Untiet, Verena; Yoo, Taekyeong; Choi, Jungmin; Xu, Shengxin; Wu, Aihua; Kirchner, Marieluise; Mertins, Philipp; Rump, Lars C; Onder, Ali Mirza; Gamble, Cory; McKenney, Daniel; Lash, Robert W; Jones, Deborah P; Chune, Gary; Gagliardi, Priscila; Choi, Murim; Gordon, Richard; Stowasser, Michael; Fahlke, Christoph; Lifton, Richard P. CLCN2 chloride channel mutations in familial hyperaldosteronism type II. Nature Genetics. 2018;50(3):349-354. PubMed |