Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MVNAGAMSGSGNLMDFLDEPFPDVGTYEDFH |
| Gene Sequence | MVNAGAMSGSGNLMDFLDEPFPDVGTYEDFH |
| Gene ID - Mouse | ENSMUSG00000004319 |
| Gene ID - Rat | ENSRNOG00000003533 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CLCN4 pAb (ATL-HPA063637) | |
| Datasheet | Anti CLCN4 pAb (ATL-HPA063637) Datasheet (External Link) |
| Vendor Page | Anti CLCN4 pAb (ATL-HPA063637) at Atlas Antibodies |
| Documents & Links for Anti CLCN4 pAb (ATL-HPA063637) | |
| Datasheet | Anti CLCN4 pAb (ATL-HPA063637) Datasheet (External Link) |
| Vendor Page | Anti CLCN4 pAb (ATL-HPA063637) |
| Citations for Anti CLCN4 pAb (ATL-HPA063637) – 1 Found |
| Gianesello, Lisa; Ceol, Monica; Bertoldi, Loris; Terrin, Liliana; Priante, Giovanna; Murer, Luisa; Peruzzi, Licia; Giordano, Mario; Paglialonga, Fabio; Cantaluppi, Vincenzo; Musetti, Claudio; Valle, Giorgio; Del Prete, Dorella; Anglani, Franca; Network, Dent Disease Italian. Genetic Analyses in Dent Disease and Characterization of CLCN5 Mutations in Kidney Biopsies. International Journal Of Molecular Sciences. 2020;21(2) PubMed |
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MVNAGAMSGSGNLMDFLDEPFPDVGTYEDFH |
| Gene Sequence | MVNAGAMSGSGNLMDFLDEPFPDVGTYEDFH |
| Gene ID - Mouse | ENSMUSG00000004319 |
| Gene ID - Rat | ENSRNOG00000003533 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CLCN4 pAb (ATL-HPA063637) | |
| Datasheet | Anti CLCN4 pAb (ATL-HPA063637) Datasheet (External Link) |
| Vendor Page | Anti CLCN4 pAb (ATL-HPA063637) at Atlas Antibodies |
| Documents & Links for Anti CLCN4 pAb (ATL-HPA063637) | |
| Datasheet | Anti CLCN4 pAb (ATL-HPA063637) Datasheet (External Link) |
| Vendor Page | Anti CLCN4 pAb (ATL-HPA063637) |
| Citations for Anti CLCN4 pAb (ATL-HPA063637) – 1 Found |
| Gianesello, Lisa; Ceol, Monica; Bertoldi, Loris; Terrin, Liliana; Priante, Giovanna; Murer, Luisa; Peruzzi, Licia; Giordano, Mario; Paglialonga, Fabio; Cantaluppi, Vincenzo; Musetti, Claudio; Valle, Giorgio; Del Prete, Dorella; Anglani, Franca; Network, Dent Disease Italian. Genetic Analyses in Dent Disease and Characterization of CLCN5 Mutations in Kidney Biopsies. International Journal Of Molecular Sciences. 2020;21(2) PubMed |