Related products

No related products found

Try browsing our complete catalog of products.

Reviews 0

No reviews have been added for this product.

Reviews

Protein Description: claudin 10
Gene Name: CLDN10
Alternative Gene Name: CPETRL3, OSP-L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022132: 79%, ENSRNOG00000010085: 82%
Entrez Gene ID: 9071
Uniprot ID: P78369
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application	IHC
Reactivity	Human
Clonality	Polyclonal
Host	Rabbit
Immunogen	ISDNNKTPRYTYNGATSVMSSRTKYHGGEDF
Gene Sequence	ISDNNKTPRYTYNGATSVMSSRTKYHGGEDF
Gene ID - Mouse	ENSMUSG00000022132
Gene ID - Rat	ENSRNOG00000010085
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CLDN10 pAb (ATL-HPA042348 w/enhanced validation)
Datasheet	Anti CLDN10 pAb (ATL-HPA042348 w/enhanced validation) Datasheet (External Link)
Vendor Page	Anti CLDN10 pAb (ATL-HPA042348 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CLDN10 pAb (ATL-HPA042348 w/enhanced validation)
Datasheet	Anti CLDN10 pAb (ATL-HPA042348 w/enhanced validation) Datasheet (External Link)
Vendor Page	Anti CLDN10 pAb (ATL-HPA042348 w/enhanced validation)

Citations for Anti CLDN10 pAb (ATL-HPA042348 w/enhanced validation) – 1 Found

Krivanek, Jan; Soldatov, Ruslan A; Kastriti, Maria Eleni; Chontorotzea, Tatiana; Herdina, Anna Nele; Petersen, Julian; Szarowska, Bara; Landova, Marie; Matejova, Veronika Kovar; Holla, Lydie Izakovicova; Kuchler, Ulrike; Zdrilic, Ivana Vidovic; Vijaykumar, Anushree; Balic, Anamaria; Marangoni, Pauline; Klein, Ophir D; Neves, Vitor C M; Yianni, Val; Sharpe, Paul T; Harkany, Tibor; Metscher, Brian D; Bajénoff, Marc; Mina, Mina; Fried, Kaj; Kharchenko, Peter V; Adameyko, Igor. Dental cell type atlas reveals stem and differentiated cell types in mouse and human teeth. Nature Communications. 2020;11(1):4816. PubMed

No related products found

Reviews 0

Reviews

Anti CLDN10 pAb (ATL-HPA042348 w/enhanced validation)

Additional information

Specifications

Reviews 0

Anti CLDN10 pAb (ATL-HPA042348 w/enhanced validation)

Additional information

Specifications

No related products found

Anti CLDN10 pAb (ATL-HPA042348 w/enhanced validation)

Additional information

Anti CLDN10 pAb (ATL-HPA042348 w/enhanced validation)

Additional information

Specifications

Specifications