Related products

No related products found

Try browsing our complete catalog of products.

Reviews 0

No reviews have been added for this product.

Reviews

Protein Description: claudin 18
Gene Name: CLDN18
Alternative Gene Name: SFTPJ
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032473: 80%, ENSRNOG00000030386: 80%
Entrez Gene ID: 51208
Uniprot ID: P56856
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application	IHC
Reactivity	Human
Clonality	Polyclonal
Host	Rabbit
Immunogen	MMCIACRGLAPEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDYV
Gene Sequence	MMCIACRGLAPEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDYV
Gene ID - Mouse	ENSMUSG00000032473
Gene ID - Rat	ENSRNOG00000030386
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CLDN18 pAb (ATL-HPA018446 w/enhanced validation)
Datasheet	Anti CLDN18 pAb (ATL-HPA018446 w/enhanced validation) Datasheet (External Link)
Vendor Page	Anti CLDN18 pAb (ATL-HPA018446 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CLDN18 pAb (ATL-HPA018446 w/enhanced validation)
Datasheet	Anti CLDN18 pAb (ATL-HPA018446 w/enhanced validation) Datasheet (External Link)
Vendor Page	Anti CLDN18 pAb (ATL-HPA018446 w/enhanced validation)

Citations for Anti CLDN18 pAb (ATL-HPA018446 w/enhanced validation) – 2 Found

McCracken, Kyle W; Aihara, Eitaro; Martin, Baptiste; Crawford, Calyn M; Broda, Taylor; Treguier, Julie; Zhang, Xinghao; Shannon, John M; Montrose, Marshall H; Wells, James M. Wnt/β-catenin promotes gastric fundus specification in mice and humans. Nature. 2017;541(7636):182-187. PubMed

Li, Jian; Zhang, Yao; Hu, Dengmin; Gong, Tuping; Xu, Run; Gao, Jun. Analysis of the expression and genetic alteration of CLDN18 in gastric cancer. Aging. 2020;12(14):14271-14284. PubMed

No related products found

Reviews 0

Reviews

Anti CLDN18 pAb (ATL-HPA018446 w/enhanced validation)

Additional information

Anti CLDN18 pAb (ATL-HPA018446 w/enhanced validation)

Additional information

Specifications

No related products found

Reviews 0

Anti CLDN18 pAb (ATL-HPA018446 w/enhanced validation)

Additional information

Specifications

Anti CLDN18 pAb (ATL-HPA018446 w/enhanced validation)

Additional information

Specifications

Specifications