Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/48819/31821/atl-hpa034794_anti-clec3b-pab-atl-hpa034794_42811__15986.1783633094.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGI |
| Gene Sequence | TGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGI |
| Gene ID - Mouse | ENSMUSG00000025784 |
| Gene ID - Rat | ENSRNOG00000004540 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CLEC3B pAb (ATL-HPA034794) | |
| Datasheet | Anti CLEC3B pAb (ATL-HPA034794) Datasheet (External Link) |
| Vendor Page | Anti CLEC3B pAb (ATL-HPA034794) at Atlas Antibodies |
| Documents & Links for Anti CLEC3B pAb (ATL-HPA034794) | |
| Datasheet | Anti CLEC3B pAb (ATL-HPA034794) Datasheet (External Link) |
| Vendor Page | Anti CLEC3B pAb (ATL-HPA034794) |
| Citations for Anti CLEC3B pAb (ATL-HPA034794) – 1 Found |
| Dodig-Crnković, Tea; Hong, Mun-Gwan; Thomas, Cecilia Engel; Häussler, Ragna S; Bendes, Annika; Dale, Matilda; Edfors, Fredrik; Forsström, Björn; Magnusson, Patrik K E; Schuppe-Koistinen, Ina; Odeberg, Jacob; Fagerberg, Linn; Gummesson, Anders; Bergström, Göran; Uhlén, Mathias; Schwenk, Jochen M. Facets of individual-specific health signatures determined from longitudinal plasma proteome profiling. Ebiomedicine. 2020;57( 32629387):102854. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGI |
| Gene Sequence | TGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGI |
| Gene ID - Mouse | ENSMUSG00000025784 |
| Gene ID - Rat | ENSRNOG00000004540 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CLEC3B pAb (ATL-HPA034794) | |
| Datasheet | Anti CLEC3B pAb (ATL-HPA034794) Datasheet (External Link) |
| Vendor Page | Anti CLEC3B pAb (ATL-HPA034794) at Atlas Antibodies |
| Documents & Links for Anti CLEC3B pAb (ATL-HPA034794) | |
| Datasheet | Anti CLEC3B pAb (ATL-HPA034794) Datasheet (External Link) |
| Vendor Page | Anti CLEC3B pAb (ATL-HPA034794) |
| Citations for Anti CLEC3B pAb (ATL-HPA034794) – 1 Found |
| Dodig-Crnković, Tea; Hong, Mun-Gwan; Thomas, Cecilia Engel; Häussler, Ragna S; Bendes, Annika; Dale, Matilda; Edfors, Fredrik; Forsström, Björn; Magnusson, Patrik K E; Schuppe-Koistinen, Ina; Odeberg, Jacob; Fagerberg, Linn; Gummesson, Anders; Bergström, Göran; Uhlén, Mathias; Schwenk, Jochen M. Facets of individual-specific health signatures determined from longitudinal plasma proteome profiling. Ebiomedicine. 2020;57( 32629387):102854. PubMed |