Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HPRRYHSSERGSRGSYREHYRSRKHKRRRSRSWSSSSDRTRRRRREDSYHVRSRSSYDDRSSDR |
| Gene Sequence | HPRRYHSSERGSRGSYREHYRSRKHKRRRSRSWSSSSDRTRRRRREDSYHVRSRSSYDDRSSDR |
| Gene ID - Mouse | ENSMUSG00000068917 |
| Gene ID - Rat | ENSRNOG00000020500 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CLK2 pAb (ATL-HPA055366) | |
| Datasheet | Anti CLK2 pAb (ATL-HPA055366) Datasheet (External Link) |
| Vendor Page | Anti CLK2 pAb (ATL-HPA055366) at Atlas Antibodies |
| Documents & Links for Anti CLK2 pAb (ATL-HPA055366) | |
| Datasheet | Anti CLK2 pAb (ATL-HPA055366) Datasheet (External Link) |
| Vendor Page | Anti CLK2 pAb (ATL-HPA055366) |
| Citations for Anti CLK2 pAb (ATL-HPA055366) – 3 Found |
| Tiek, Deanna M; Erdogdu, Beril; Razaghi, Roham; Jin, Lu; Sadowski, Norah; Alamillo-Ferrer, Carla; Hogg, J Robert; Haddad, Bassem R; Drewry, David H; Wells, Carrow I; Pickett, Julie E; Song, Xiao; Goenka, Anshika; Hu, Bo; Goldlust, Samuel A; Zuercher, William J; Pertea, Mihaela; Timp, Winston; Cheng, Shi-Yuan; Riggins, Rebecca B. Temozolomide-induced guanine mutations create exploitable vulnerabilities of guanine-rich DNA and RNA regions in drug-resistant gliomas. Science Advances. 2022;8(25):eabn3471. PubMed |
| Park, Soon Young; Piao, Yuji; Thomas, Craig; Fuller, Gregory N; de Groot, John F. Cdc2-like kinase 2 is a key regulator of the cell cycle via FOXO3a/p27 in glioblastoma. Oncotarget. 2016;7(18):26793-805. PubMed |
| Park, Soon Young; Mittal, Sandeep; Dong, Jianwen; Jeong, Kangjin; Martinez-Ledesma, Emmanuel; Piao, Yuji; Khan, Sabbir; Henry, Verlene; Verhaak, Roel Gw; Majd, Nazanin; Balasubramaniyan, Veerakumar; de Groot, John F. Depletion of CLK2 sensitizes glioma stem-like cells to PI3K/mTOR and FGFR inhibitors. American Journal Of Cancer Research. 10(11):3765-3783. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HPRRYHSSERGSRGSYREHYRSRKHKRRRSRSWSSSSDRTRRRRREDSYHVRSRSSYDDRSSDR |
| Gene Sequence | HPRRYHSSERGSRGSYREHYRSRKHKRRRSRSWSSSSDRTRRRRREDSYHVRSRSSYDDRSSDR |
| Gene ID - Mouse | ENSMUSG00000068917 |
| Gene ID - Rat | ENSRNOG00000020500 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CLK2 pAb (ATL-HPA055366) | |
| Datasheet | Anti CLK2 pAb (ATL-HPA055366) Datasheet (External Link) |
| Vendor Page | Anti CLK2 pAb (ATL-HPA055366) at Atlas Antibodies |
| Documents & Links for Anti CLK2 pAb (ATL-HPA055366) | |
| Datasheet | Anti CLK2 pAb (ATL-HPA055366) Datasheet (External Link) |
| Vendor Page | Anti CLK2 pAb (ATL-HPA055366) |
| Citations for Anti CLK2 pAb (ATL-HPA055366) – 3 Found |
| Tiek, Deanna M; Erdogdu, Beril; Razaghi, Roham; Jin, Lu; Sadowski, Norah; Alamillo-Ferrer, Carla; Hogg, J Robert; Haddad, Bassem R; Drewry, David H; Wells, Carrow I; Pickett, Julie E; Song, Xiao; Goenka, Anshika; Hu, Bo; Goldlust, Samuel A; Zuercher, William J; Pertea, Mihaela; Timp, Winston; Cheng, Shi-Yuan; Riggins, Rebecca B. Temozolomide-induced guanine mutations create exploitable vulnerabilities of guanine-rich DNA and RNA regions in drug-resistant gliomas. Science Advances. 2022;8(25):eabn3471. PubMed |
| Park, Soon Young; Piao, Yuji; Thomas, Craig; Fuller, Gregory N; de Groot, John F. Cdc2-like kinase 2 is a key regulator of the cell cycle via FOXO3a/p27 in glioblastoma. Oncotarget. 2016;7(18):26793-805. PubMed |
| Park, Soon Young; Mittal, Sandeep; Dong, Jianwen; Jeong, Kangjin; Martinez-Ledesma, Emmanuel; Piao, Yuji; Khan, Sabbir; Henry, Verlene; Verhaak, Roel Gw; Majd, Nazanin; Balasubramaniyan, Veerakumar; de Groot, John F. Depletion of CLK2 sensitizes glioma stem-like cells to PI3K/mTOR and FGFR inhibitors. American Journal Of Cancer Research. 10(11):3765-3783. PubMed |