Loading...
Loading...
Loading...
Loading...
Atlas Antibodies

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/59781/49465/atl-hpa066046_anti-cln6-pab-atl-hpa066046_61070__14569.1783645161.jpg?compression=lossy)

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/59781/49465/atl-hpa066046_anti-cln6-pab-atl-hpa066046_61070__14569.1783645161.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | WNDPVLRKKYPGVIYVPEPWAFYTLHVSSR |
| Gene Sequence | WNDPVLRKKYPGVIYVPEPWAFYTLHVSSR |
| Gene ID - Mouse | ENSMUSG00000032245 |
| Gene ID - Rat | ENSRNOG00000007164 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CLN6 pAb (ATL-HPA066046) | |
| Datasheet | Anti CLN6 pAb (ATL-HPA066046) Datasheet (External Link) |
| Vendor Page | Anti CLN6 pAb (ATL-HPA066046) at Atlas Antibodies |
| Documents & Links for Anti CLN6 pAb (ATL-HPA066046) | |
| Datasheet | Anti CLN6 pAb (ATL-HPA066046) Datasheet (External Link) |
| Vendor Page | Anti CLN6 pAb (ATL-HPA066046) |
No reviews have been added for this product.
Try browsing our complete catalog of products.
Atlas Antibodies

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/59781/49465/atl-hpa066046_anti-cln6-pab-atl-hpa066046_61070__14569.1783645161.jpg?compression=lossy)

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/59781/49465/atl-hpa066046_anti-cln6-pab-atl-hpa066046_61070__14569.1783645161.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | WNDPVLRKKYPGVIYVPEPWAFYTLHVSSR |
| Gene Sequence | WNDPVLRKKYPGVIYVPEPWAFYTLHVSSR |
| Gene ID - Mouse | ENSMUSG00000032245 |
| Gene ID - Rat | ENSRNOG00000007164 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CLN6 pAb (ATL-HPA066046) | |
| Datasheet | Anti CLN6 pAb (ATL-HPA066046) Datasheet (External Link) |
| Vendor Page | Anti CLN6 pAb (ATL-HPA066046) at Atlas Antibodies |
| Documents & Links for Anti CLN6 pAb (ATL-HPA066046) | |
| Datasheet | Anti CLN6 pAb (ATL-HPA066046) Datasheet (External Link) |
| Vendor Page | Anti CLN6 pAb (ATL-HPA066046) |