Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue<br/>Lane 6: Human Tonsil tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/55416/43218/atl-hpa050918_anti-clta-pab-atl-hpa050918-wenhanced-validation_54590__54249.1783640947.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NDEAFAILDGGAPGPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPE |
| Gene Sequence | NDEAFAILDGGAPGPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPE |
| Gene ID - Mouse | ENSMUSG00000028478 |
| Gene ID - Rat | ENSRNOG00000014635 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CLTA pAb (ATL-HPA050918 w/enhanced validation) | |
| Datasheet | Anti CLTA pAb (ATL-HPA050918 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CLTA pAb (ATL-HPA050918 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CLTA pAb (ATL-HPA050918 w/enhanced validation) | |
| Datasheet | Anti CLTA pAb (ATL-HPA050918 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CLTA pAb (ATL-HPA050918 w/enhanced validation) |
| Citations for Anti CLTA pAb (ATL-HPA050918 w/enhanced validation) – 2 Found |
| Chen, Ping-Hung; Bendris, Nawal; Hsiao, Yi-Jing; Reis, Carlos R; Mettlen, Marcel; Chen, Hsuan-Yu; Yu, Sung-Liang; Schmid, Sandra L. Crosstalk between CLCb/Dyn1-Mediated Adaptive Clathrin-Mediated Endocytosis and Epidermal Growth Factor Receptor Signaling Increases Metastasis. Developmental Cell. 2017;40(3):278-288.e5. PubMed |
| Obashi, Kazuki; Sochacki, Kem A; Strub, Marie-Paule; Taraska, Justin W. A conformational switch in clathrin light chain regulates lattice structure and endocytosis at the plasma membrane of mammalian cells. Nature Communications. 2023;14(1):732. PubMed |
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NDEAFAILDGGAPGPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPE |
| Gene Sequence | NDEAFAILDGGAPGPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPE |
| Gene ID - Mouse | ENSMUSG00000028478 |
| Gene ID - Rat | ENSRNOG00000014635 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CLTA pAb (ATL-HPA050918 w/enhanced validation) | |
| Datasheet | Anti CLTA pAb (ATL-HPA050918 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CLTA pAb (ATL-HPA050918 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CLTA pAb (ATL-HPA050918 w/enhanced validation) | |
| Datasheet | Anti CLTA pAb (ATL-HPA050918 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CLTA pAb (ATL-HPA050918 w/enhanced validation) |
| Citations for Anti CLTA pAb (ATL-HPA050918 w/enhanced validation) – 2 Found |
| Chen, Ping-Hung; Bendris, Nawal; Hsiao, Yi-Jing; Reis, Carlos R; Mettlen, Marcel; Chen, Hsuan-Yu; Yu, Sung-Liang; Schmid, Sandra L. Crosstalk between CLCb/Dyn1-Mediated Adaptive Clathrin-Mediated Endocytosis and Epidermal Growth Factor Receptor Signaling Increases Metastasis. Developmental Cell. 2017;40(3):278-288.e5. PubMed |
| Obashi, Kazuki; Sochacki, Kem A; Strub, Marie-Paule; Taraska, Justin W. A conformational switch in clathrin light chain regulates lattice structure and endocytosis at the plasma membrane of mammalian cells. Nature Communications. 2023;14(1):732. PubMed |