Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/51099/35969/atl-hpa039905_anti-cmas-pab-atl-hpa039905_47068__58033.1783636026.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KMEVSVSDKLAVVDEWRKEMGLCWKEVAYLGNEVSDEECLKRVGLSGAPADACSTAQKAVGYICKCNGGRGAIREFAEHICLLMEKVNNSCQ |
| Gene Sequence | KMEVSVSDKLAVVDEWRKEMGLCWKEVAYLGNEVSDEECLKRVGLSGAPADACSTAQKAVGYICKCNGGRGAIREFAEHICLLMEKVNNSCQ |
| Gene ID - Mouse | ENSMUSG00000030282 |
| Gene ID - Rat | ENSRNOG00000013816 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CMAS pAb (ATL-HPA039905) | |
| Datasheet | Anti CMAS pAb (ATL-HPA039905) Datasheet (External Link) |
| Vendor Page | Anti CMAS pAb (ATL-HPA039905) at Atlas Antibodies |
| Documents & Links for Anti CMAS pAb (ATL-HPA039905) | |
| Datasheet | Anti CMAS pAb (ATL-HPA039905) Datasheet (External Link) |
| Vendor Page | Anti CMAS pAb (ATL-HPA039905) |
| Citations for Anti CMAS pAb (ATL-HPA039905) – 2 Found |
| Teoh, Shao Thing; Ogrodzinski, Martin P; Ross, Christina; Hunter, Kent W; Lunt, Sophia Y. Sialic Acid Metabolism: A Key Player in Breast Cancer Metastasis Revealed by Metabolomics. Frontiers In Oncology. 8( 29892572):174. PubMed |
| Metcalf, Kevin James; Hayward, Mary-Kate; Berens, Eric; Ironside, Alastair J; Stashko, Connor; Hwang, E Shelley; Weaver, Valerie M. Immunosuppressive glycoproteins associate with breast tumor fibrosis and aggression. Matrix Biology Plus. 2022;14( 35392183):100105. PubMed |
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KMEVSVSDKLAVVDEWRKEMGLCWKEVAYLGNEVSDEECLKRVGLSGAPADACSTAQKAVGYICKCNGGRGAIREFAEHICLLMEKVNNSCQ |
| Gene Sequence | KMEVSVSDKLAVVDEWRKEMGLCWKEVAYLGNEVSDEECLKRVGLSGAPADACSTAQKAVGYICKCNGGRGAIREFAEHICLLMEKVNNSCQ |
| Gene ID - Mouse | ENSMUSG00000030282 |
| Gene ID - Rat | ENSRNOG00000013816 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CMAS pAb (ATL-HPA039905) | |
| Datasheet | Anti CMAS pAb (ATL-HPA039905) Datasheet (External Link) |
| Vendor Page | Anti CMAS pAb (ATL-HPA039905) at Atlas Antibodies |
| Documents & Links for Anti CMAS pAb (ATL-HPA039905) | |
| Datasheet | Anti CMAS pAb (ATL-HPA039905) Datasheet (External Link) |
| Vendor Page | Anti CMAS pAb (ATL-HPA039905) |
| Citations for Anti CMAS pAb (ATL-HPA039905) – 2 Found |
| Teoh, Shao Thing; Ogrodzinski, Martin P; Ross, Christina; Hunter, Kent W; Lunt, Sophia Y. Sialic Acid Metabolism: A Key Player in Breast Cancer Metastasis Revealed by Metabolomics. Frontiers In Oncology. 8( 29892572):174. PubMed |
| Metcalf, Kevin James; Hayward, Mary-Kate; Berens, Eric; Ironside, Alastair J; Stashko, Connor; Hwang, E Shelley; Weaver, Valerie M. Immunosuppressive glycoproteins associate with breast tumor fibrosis and aggression. Matrix Biology Plus. 2022;14( 35392183):100105. PubMed |