Loading...
Loading...
Loading...
Loading...
Atlas Antibodies
![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/52714/38859/atl-hpa043333_anti-cmc1-pab-atl-hpa043333_50048__97177.1783637990.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RCSEQVQDFTKCCKNSGVLMVVKCRKENSALKECLTAYYNDPAFYEECKMEYLKEREEFRKTGIPTKKRLQKLPTSM |
| Gene Sequence | RCSEQVQDFTKCCKNSGVLMVVKCRKENSALKECLTAYYNDPAFYEECKMEYLKEREEFRKTGIPTKKRLQKLPTSM |
| Gene ID - Mouse | ENSMUSG00000039163 |
| Gene ID - Rat | ENSRNOG00000010149 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CMC1 pAb (ATL-HPA043333) | |
| Datasheet | Anti CMC1 pAb (ATL-HPA043333) Datasheet (External Link) |
| Vendor Page | Anti CMC1 pAb (ATL-HPA043333) at Atlas Antibodies |
| Documents & Links for Anti CMC1 pAb (ATL-HPA043333) | |
| Datasheet | Anti CMC1 pAb (ATL-HPA043333) Datasheet (External Link) |
| Vendor Page | Anti CMC1 pAb (ATL-HPA043333) |
| Citations for Anti CMC1 pAb (ATL-HPA043333) – 2 Found |
| Bourens, Myriam; Barrientos, Antoni. A CMC1-knockout reveals translation-independent control of human mitochondrial complex IV biogenesis. Embo Reports. 2017;18(3):477-494. PubMed |
| Nývltová, Eva; Dietz, Jonathan V; Seravalli, Javier; Khalimonchuk, Oleh; Barrientos, Antoni. Coordination of metal center biogenesis in human cytochrome c oxidase. Nature Communications. 2022;13(1):3615. PubMed |
Atlas Antibodies
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RCSEQVQDFTKCCKNSGVLMVVKCRKENSALKECLTAYYNDPAFYEECKMEYLKEREEFRKTGIPTKKRLQKLPTSM |
| Gene Sequence | RCSEQVQDFTKCCKNSGVLMVVKCRKENSALKECLTAYYNDPAFYEECKMEYLKEREEFRKTGIPTKKRLQKLPTSM |
| Gene ID - Mouse | ENSMUSG00000039163 |
| Gene ID - Rat | ENSRNOG00000010149 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CMC1 pAb (ATL-HPA043333) | |
| Datasheet | Anti CMC1 pAb (ATL-HPA043333) Datasheet (External Link) |
| Vendor Page | Anti CMC1 pAb (ATL-HPA043333) at Atlas Antibodies |
| Documents & Links for Anti CMC1 pAb (ATL-HPA043333) | |
| Datasheet | Anti CMC1 pAb (ATL-HPA043333) Datasheet (External Link) |
| Vendor Page | Anti CMC1 pAb (ATL-HPA043333) |
| Citations for Anti CMC1 pAb (ATL-HPA043333) – 2 Found |
| Bourens, Myriam; Barrientos, Antoni. A CMC1-knockout reveals translation-independent control of human mitochondrial complex IV biogenesis. Embo Reports. 2017;18(3):477-494. PubMed |
| Nývltová, Eva; Dietz, Jonathan V; Seravalli, Javier; Khalimonchuk, Oleh; Barrientos, Antoni. Coordination of metal center biogenesis in human cytochrome c oxidase. Nature Communications. 2022;13(1):3615. PubMed |
No reviews have been added for this product.
Try browsing our complete catalog of products.