Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESLEKRIQTYLQSTKPIIDLYEEMGKVKK |
| Gene Sequence | NLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESLEKRIQTYLQSTKPIIDLYEEMGKVKK |
| Gene ID - Mouse | ENSMUSG00000028719 |
| Gene ID - Rat | ENSRNOG00000007775 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CMPK1 pAb (ATL-HPA053730 w/enhanced validation) | |
| Datasheet | Anti CMPK1 pAb (ATL-HPA053730 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CMPK1 pAb (ATL-HPA053730 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CMPK1 pAb (ATL-HPA053730 w/enhanced validation) | |
| Datasheet | Anti CMPK1 pAb (ATL-HPA053730 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CMPK1 pAb (ATL-HPA053730 w/enhanced validation) |
| Citations for Anti CMPK1 pAb (ATL-HPA053730 w/enhanced validation) – 1 Found |
| Ryu, Jae Yong; Kim, Hyun Uk; Lee, Sang Yup. Framework and resource for more than 11,000 gene-transcript-protein-reaction associations in human metabolism. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2017;114(45):E9740-E9749. PubMed |
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESLEKRIQTYLQSTKPIIDLYEEMGKVKK |
| Gene Sequence | NLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESLEKRIQTYLQSTKPIIDLYEEMGKVKK |
| Gene ID - Mouse | ENSMUSG00000028719 |
| Gene ID - Rat | ENSRNOG00000007775 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CMPK1 pAb (ATL-HPA053730 w/enhanced validation) | |
| Datasheet | Anti CMPK1 pAb (ATL-HPA053730 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CMPK1 pAb (ATL-HPA053730 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CMPK1 pAb (ATL-HPA053730 w/enhanced validation) | |
| Datasheet | Anti CMPK1 pAb (ATL-HPA053730 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CMPK1 pAb (ATL-HPA053730 w/enhanced validation) |
| Citations for Anti CMPK1 pAb (ATL-HPA053730 w/enhanced validation) – 1 Found |
| Ryu, Jae Yong; Kim, Hyun Uk; Lee, Sang Yup. Framework and resource for more than 11,000 gene-transcript-protein-reaction associations in human metabolism. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2017;114(45):E9740-E9749. PubMed |