Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KWRVSVRQQSTNDYIRARTESRDVDSRPEIQRLDTFSYSTNVTVRKKSPTNLLSLNHWQ |
| Gene Sequence | KWRVSVRQQSTNDYIRARTESRDVDSRPEIQRLDTFSYSTNVTVRKKSPTNLLSLNHWQ |
| Gene ID - Mouse | ENSMUSG00000096188 |
| Gene ID - Rat | ENSRNOG00000011009 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CMTM4 pAb (ATL-HPA014704 w/enhanced validation) | |
| Datasheet | Anti CMTM4 pAb (ATL-HPA014704 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CMTM4 pAb (ATL-HPA014704 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CMTM4 pAb (ATL-HPA014704 w/enhanced validation) | |
| Datasheet | Anti CMTM4 pAb (ATL-HPA014704 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CMTM4 pAb (ATL-HPA014704 w/enhanced validation) |
| Citations for Anti CMTM4 pAb (ATL-HPA014704 w/enhanced validation) – 2 Found |
| Mezzadra, Riccardo; Sun, Chong; Jae, Lucas T; Gomez-Eerland, Raquel; de Vries, Evert; Wu, Wei; Logtenberg, Meike E W; Slagter, Maarten; Rozeman, Elisa A; Hofland, Ingrid; Broeks, Annegien; Horlings, Hugo M; Wessels, Lodewyk F A; Blank, Christian U; Xiao, Yanling; Heck, Albert J R; Borst, Jannie; Brummelkamp, Thijn R; Schumacher, Ton N M. Identification of CMTM6 and CMTM4 as PD-L1 protein regulators. Nature. 2017;549(7670):106-110. PubMed |
| Knizkova, Daniela; Pribikova, Michaela; Draberova, Helena; Semberova, Tereza; Trivic, Tijana; Synackova, Alzbeta; Ujevic, Andrea; Stefanovic, Jana; Drobek, Ales; Huranova, Martina; Niederlova, Veronika; Tsyklauri, Oksana; Neuwirth, Ales; Tureckova, Jolana; Stepanek, Ondrej; Draber, Peter. CMTM4 is a subunit of the IL-17 receptor and mediates autoimmune pathology. Nature Immunology. 2022;23(11):1644-1652. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KWRVSVRQQSTNDYIRARTESRDVDSRPEIQRLDTFSYSTNVTVRKKSPTNLLSLNHWQ |
| Gene Sequence | KWRVSVRQQSTNDYIRARTESRDVDSRPEIQRLDTFSYSTNVTVRKKSPTNLLSLNHWQ |
| Gene ID - Mouse | ENSMUSG00000096188 |
| Gene ID - Rat | ENSRNOG00000011009 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CMTM4 pAb (ATL-HPA014704 w/enhanced validation) | |
| Datasheet | Anti CMTM4 pAb (ATL-HPA014704 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CMTM4 pAb (ATL-HPA014704 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CMTM4 pAb (ATL-HPA014704 w/enhanced validation) | |
| Datasheet | Anti CMTM4 pAb (ATL-HPA014704 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CMTM4 pAb (ATL-HPA014704 w/enhanced validation) |
| Citations for Anti CMTM4 pAb (ATL-HPA014704 w/enhanced validation) – 2 Found |
| Mezzadra, Riccardo; Sun, Chong; Jae, Lucas T; Gomez-Eerland, Raquel; de Vries, Evert; Wu, Wei; Logtenberg, Meike E W; Slagter, Maarten; Rozeman, Elisa A; Hofland, Ingrid; Broeks, Annegien; Horlings, Hugo M; Wessels, Lodewyk F A; Blank, Christian U; Xiao, Yanling; Heck, Albert J R; Borst, Jannie; Brummelkamp, Thijn R; Schumacher, Ton N M. Identification of CMTM6 and CMTM4 as PD-L1 protein regulators. Nature. 2017;549(7670):106-110. PubMed |
| Knizkova, Daniela; Pribikova, Michaela; Draberova, Helena; Semberova, Tereza; Trivic, Tijana; Synackova, Alzbeta; Ujevic, Andrea; Stefanovic, Jana; Drobek, Ales; Huranova, Martina; Niederlova, Veronika; Tsyklauri, Oksana; Neuwirth, Ales; Tureckova, Jolana; Stepanek, Ondrej; Draber, Peter. CMTM4 is a subunit of the IL-17 receptor and mediates autoimmune pathology. Nature Immunology. 2022;23(11):1644-1652. PubMed |