Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DDVRDYLFAVNIKLNQLRNTDSDVNLVVPLEVIKGDHEFTDYMIRSNESHCSLQIKALAKIHAFVQDTTLSEPRQAEIRKECLRLWGIPDQARVAPSSSDPKS |
| Gene Sequence | DDVRDYLFAVNIKLNQLRNTDSDVNLVVPLEVIKGDHEFTDYMIRSNESHCSLQIKALAKIHAFVQDTTLSEPRQAEIRKECLRLWGIPDQARVAPSSSDPKS |
| Gene ID - Mouse | ENSMUSG00000024019 |
| Gene ID - Rat | ENSRNOG00000000532 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CMTR1 pAb (ATL-HPA029980 w/enhanced validation) | |
| Datasheet | Anti CMTR1 pAb (ATL-HPA029980 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CMTR1 pAb (ATL-HPA029980 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CMTR1 pAb (ATL-HPA029980 w/enhanced validation) | |
| Datasheet | Anti CMTR1 pAb (ATL-HPA029980 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CMTR1 pAb (ATL-HPA029980 w/enhanced validation) |
| Citations for Anti CMTR1 pAb (ATL-HPA029980 w/enhanced validation) – 2 Found |
| Williams, Graham D; Gokhale, Nandan S; Snider, Daltry L; Horner, Stacy M. The mRNA Cap 2'-O-Methyltransferase CMTR1 Regulates the Expression of Certain Interferon-Stimulated Genes. Msphere. 2020;5(3) PubMed |
| Drazkowska, Karolina; Tomecki, Rafal; Warminski, Marcin; Baran, Natalia; Cysewski, Dominik; Depaix, Anaïs; Kasprzyk, Renata; Kowalska, Joanna; Jemielity, Jacek; Sikorski, Pawel J. 2'-O-Methylation of the second transcribed nucleotide within the mRNA 5' cap impacts the protein production level in a cell-specific manner and contributes to RNA immune evasion. Nucleic Acids Research. 2022;50(16):9051-9071. PubMed |
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DDVRDYLFAVNIKLNQLRNTDSDVNLVVPLEVIKGDHEFTDYMIRSNESHCSLQIKALAKIHAFVQDTTLSEPRQAEIRKECLRLWGIPDQARVAPSSSDPKS |
| Gene Sequence | DDVRDYLFAVNIKLNQLRNTDSDVNLVVPLEVIKGDHEFTDYMIRSNESHCSLQIKALAKIHAFVQDTTLSEPRQAEIRKECLRLWGIPDQARVAPSSSDPKS |
| Gene ID - Mouse | ENSMUSG00000024019 |
| Gene ID - Rat | ENSRNOG00000000532 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CMTR1 pAb (ATL-HPA029980 w/enhanced validation) | |
| Datasheet | Anti CMTR1 pAb (ATL-HPA029980 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CMTR1 pAb (ATL-HPA029980 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CMTR1 pAb (ATL-HPA029980 w/enhanced validation) | |
| Datasheet | Anti CMTR1 pAb (ATL-HPA029980 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CMTR1 pAb (ATL-HPA029980 w/enhanced validation) |
| Citations for Anti CMTR1 pAb (ATL-HPA029980 w/enhanced validation) – 2 Found |
| Williams, Graham D; Gokhale, Nandan S; Snider, Daltry L; Horner, Stacy M. The mRNA Cap 2'-O-Methyltransferase CMTR1 Regulates the Expression of Certain Interferon-Stimulated Genes. Msphere. 2020;5(3) PubMed |
| Drazkowska, Karolina; Tomecki, Rafal; Warminski, Marcin; Baran, Natalia; Cysewski, Dominik; Depaix, Anaïs; Kasprzyk, Renata; Kowalska, Joanna; Jemielity, Jacek; Sikorski, Pawel J. 2'-O-Methylation of the second transcribed nucleotide within the mRNA 5' cap impacts the protein production level in a cell-specific manner and contributes to RNA immune evasion. Nucleic Acids Research. 2022;50(16):9051-9071. PubMed |