Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLPDGQSLPIPPVILAELGSDPTKGTVCFYGHL |
| Gene Sequence | PALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLPDGQSLPIPPVILAELGSDPTKGTVCFYGHL |
| Gene ID - Mouse | ENSMUSG00000056162 |
| Gene ID - Rat | ENSRNOG00000027739 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CNDP1 pAb (ATL-HPA008933 w/enhanced validation) | |
| Datasheet | Anti CNDP1 pAb (ATL-HPA008933 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CNDP1 pAb (ATL-HPA008933 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CNDP1 pAb (ATL-HPA008933 w/enhanced validation) | |
| Datasheet | Anti CNDP1 pAb (ATL-HPA008933 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CNDP1 pAb (ATL-HPA008933 w/enhanced validation) |
| Citations for Anti CNDP1 pAb (ATL-HPA008933 w/enhanced validation) – 6 Found |
| Peters, Verena; Kebbewar, Moustafa; Jansen, Erwin W; Jakobs, Cornelis; Riedl, Eva; Koeppel, Hannes; Frey, Dirk; Adelmann, Katja; Klingbeil, Kristina; Mack, Matthias; Hoffmann, Georg F; Janssen, Bart; Zschocke, Johannes; Yard, Benito A. Relevance of allosteric conformations and homocarnosine concentration on carnosinase activity. Amino Acids. 2010;38(5):1607-15. PubMed |
| Schwenk, Jochen M; Igel, Ulrika; Neiman, Maja; Langen, Hanno; Becker, Charlotte; Bjartell, Anders; Ponten, Fredrik; Wiklund, Fredrik; Grönberg, Henrik; Nilsson, Peter; Uhlen, Mathias. Toward next generation plasma profiling via heat-induced epitope retrieval and array-based assays. Molecular & Cellular Proteomics : Mcp. 2010;9(11):2497-507. PubMed |
| Hjelm, Barbara; Forsström, Björn; Igel, Ulrika; Johannesson, Henrik; Stadler, Charlotte; Lundberg, Emma; Ponten, Fredrik; Sjöberg, Anna; Rockberg, Johan; Schwenk, Jochen M; Nilsson, Peter; Johansson, Christine; Uhlén, Mathias. Generation of monospecific antibodies based on affinity capture of polyclonal antibodies. Protein Science : A Publication Of The Protein Society. 2011;20(11):1824-35. PubMed |
| Adelmann, Katja; Frey, Dirk; Riedl, Eva; Koeppel, Hannes; Pfister, Frederick; Peters, Verena; Schmitt, Claus P; Sternik, Paula; Hofmann, Stephanie; Zentgraf, Hans Walter; Navis, Gerjan; van den Born, Jacob; Bakker, Stephan J L; Krämer, Bernhard K; Yard, Benito A; Hauske, Sibylle J. Different conformational forms of serum carnosinase detected by a newly developed sandwich ELISA for the measurements of carnosinase concentrations. Amino Acids. 2012;43(1):143-51. PubMed |
| Arner, Peter; Henjes, Frauke; Schwenk, Jochen M; Darmanis, Spyros; Dahlman, Ingrid; Iresjö, Britt-Marie; Naredi, Peter; Agustsson, Thorhallur; Lundholm, Kent; Nilsson, Peter; Rydén, Mikael. Circulating carnosine dipeptidase 1 associates with weight loss and poor prognosis in gastrointestinal cancer. Plos One. 10(4):e0123566. PubMed |
| Zhou, Zhou; Liu, Xue-Qi; Zhang, Shi-Qi; Qi, Xiang-Ming; Zhang, Qiu; Yard, Benito; Wu, Yong-Gui. Correlation between serum carnosinase concentration and renal damage in diabetic nephropathy patients. Amino Acids. 2021;53(5):687-700. PubMed |


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLPDGQSLPIPPVILAELGSDPTKGTVCFYGHL |
| Gene Sequence | PALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLPDGQSLPIPPVILAELGSDPTKGTVCFYGHL |
| Gene ID - Mouse | ENSMUSG00000056162 |
| Gene ID - Rat | ENSRNOG00000027739 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CNDP1 pAb (ATL-HPA008933 w/enhanced validation) | |
| Datasheet | Anti CNDP1 pAb (ATL-HPA008933 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CNDP1 pAb (ATL-HPA008933 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CNDP1 pAb (ATL-HPA008933 w/enhanced validation) | |
| Datasheet | Anti CNDP1 pAb (ATL-HPA008933 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CNDP1 pAb (ATL-HPA008933 w/enhanced validation) |
| Citations for Anti CNDP1 pAb (ATL-HPA008933 w/enhanced validation) – 6 Found |
| Peters, Verena; Kebbewar, Moustafa; Jansen, Erwin W; Jakobs, Cornelis; Riedl, Eva; Koeppel, Hannes; Frey, Dirk; Adelmann, Katja; Klingbeil, Kristina; Mack, Matthias; Hoffmann, Georg F; Janssen, Bart; Zschocke, Johannes; Yard, Benito A. Relevance of allosteric conformations and homocarnosine concentration on carnosinase activity. Amino Acids. 2010;38(5):1607-15. PubMed |
| Schwenk, Jochen M; Igel, Ulrika; Neiman, Maja; Langen, Hanno; Becker, Charlotte; Bjartell, Anders; Ponten, Fredrik; Wiklund, Fredrik; Grönberg, Henrik; Nilsson, Peter; Uhlen, Mathias. Toward next generation plasma profiling via heat-induced epitope retrieval and array-based assays. Molecular & Cellular Proteomics : Mcp. 2010;9(11):2497-507. PubMed |
| Hjelm, Barbara; Forsström, Björn; Igel, Ulrika; Johannesson, Henrik; Stadler, Charlotte; Lundberg, Emma; Ponten, Fredrik; Sjöberg, Anna; Rockberg, Johan; Schwenk, Jochen M; Nilsson, Peter; Johansson, Christine; Uhlén, Mathias. Generation of monospecific antibodies based on affinity capture of polyclonal antibodies. Protein Science : A Publication Of The Protein Society. 2011;20(11):1824-35. PubMed |
| Adelmann, Katja; Frey, Dirk; Riedl, Eva; Koeppel, Hannes; Pfister, Frederick; Peters, Verena; Schmitt, Claus P; Sternik, Paula; Hofmann, Stephanie; Zentgraf, Hans Walter; Navis, Gerjan; van den Born, Jacob; Bakker, Stephan J L; Krämer, Bernhard K; Yard, Benito A; Hauske, Sibylle J. Different conformational forms of serum carnosinase detected by a newly developed sandwich ELISA for the measurements of carnosinase concentrations. Amino Acids. 2012;43(1):143-51. PubMed |
| Arner, Peter; Henjes, Frauke; Schwenk, Jochen M; Darmanis, Spyros; Dahlman, Ingrid; Iresjö, Britt-Marie; Naredi, Peter; Agustsson, Thorhallur; Lundholm, Kent; Nilsson, Peter; Rydén, Mikael. Circulating carnosine dipeptidase 1 associates with weight loss and poor prognosis in gastrointestinal cancer. Plos One. 10(4):e0123566. PubMed |
| Zhou, Zhou; Liu, Xue-Qi; Zhang, Shi-Qi; Qi, Xiang-Ming; Zhang, Qiu; Yard, Benito; Wu, Yong-Gui. Correlation between serum carnosinase concentration and renal damage in diabetic nephropathy patients. Amino Acids. 2021;53(5):687-700. PubMed |