Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ADDLKKLKPGLEKDFLPLYFGWFLTKKSSETLRKAGQVFLEELGNHKAFKKELRQFVPGDEPREKMDLVTYFG |
| Gene Sequence | ADDLKKLKPGLEKDFLPLYFGWFLTKKSSETLRKAGQVFLEELGNHKAFKKELRQFVPGDEPREKMDLVTYFG |
| Gene ID - Mouse | ENSMUSG00000006782 |
| Gene ID - Rat | ENSRNOG00000017496 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CNP pAb (ATL-HPA023266 w/enhanced validation) | |
| Datasheet | Anti CNP pAb (ATL-HPA023266 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CNP pAb (ATL-HPA023266 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CNP pAb (ATL-HPA023266 w/enhanced validation) | |
| Datasheet | Anti CNP pAb (ATL-HPA023266 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CNP pAb (ATL-HPA023266 w/enhanced validation) |
| Citations for Anti CNP pAb (ATL-HPA023266 w/enhanced validation) – 2 Found |
| Wüthrich, Christian; Batson, Stephanie; Anderson, Matthew P; White, Lon R; Koralnik, Igor J. JC Virus Infects Neurons and Glial Cells in the Hippocampus. Journal Of Neuropathology And Experimental Neurology. 2016;75(8):712-717. PubMed |
| Peluffo, Hugo; Alí-Ruiz, Daniela; Ejarque-Ortíz, Aroa; Heras-Alvarez, Victor; Comas-Casellas, Emma; Martínez-Barriocanal, Agueda; Kamaid, Andres; Alvarez-Errico, Damiana; Negro, Maria Luciana; Lago, Natalia; Schwartz, Simó Jr; Villaverde, Antonio; Sayós, Joan. Overexpression of the immunoreceptor CD300f has a neuroprotective role in a model of acute brain injury. Brain Pathology (Zurich, Switzerland). 2012;22(3):318-28. PubMed |
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ADDLKKLKPGLEKDFLPLYFGWFLTKKSSETLRKAGQVFLEELGNHKAFKKELRQFVPGDEPREKMDLVTYFG |
| Gene Sequence | ADDLKKLKPGLEKDFLPLYFGWFLTKKSSETLRKAGQVFLEELGNHKAFKKELRQFVPGDEPREKMDLVTYFG |
| Gene ID - Mouse | ENSMUSG00000006782 |
| Gene ID - Rat | ENSRNOG00000017496 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CNP pAb (ATL-HPA023266 w/enhanced validation) | |
| Datasheet | Anti CNP pAb (ATL-HPA023266 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CNP pAb (ATL-HPA023266 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CNP pAb (ATL-HPA023266 w/enhanced validation) | |
| Datasheet | Anti CNP pAb (ATL-HPA023266 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CNP pAb (ATL-HPA023266 w/enhanced validation) |
| Citations for Anti CNP pAb (ATL-HPA023266 w/enhanced validation) – 2 Found |
| Wüthrich, Christian; Batson, Stephanie; Anderson, Matthew P; White, Lon R; Koralnik, Igor J. JC Virus Infects Neurons and Glial Cells in the Hippocampus. Journal Of Neuropathology And Experimental Neurology. 2016;75(8):712-717. PubMed |
| Peluffo, Hugo; Alí-Ruiz, Daniela; Ejarque-Ortíz, Aroa; Heras-Alvarez, Victor; Comas-Casellas, Emma; Martínez-Barriocanal, Agueda; Kamaid, Andres; Alvarez-Errico, Damiana; Negro, Maria Luciana; Lago, Natalia; Schwartz, Simó Jr; Villaverde, Antonio; Sayós, Joan. Overexpression of the immunoreceptor CD300f has a neuroprotective role in a model of acute brain injury. Brain Pathology (Zurich, Switzerland). 2012;22(3):318-28. PubMed |